KEGG   Schizophyllum commune: SCHCODRAFT_81883Help
Entry
SCHCODRAFT_81883  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scm  Schizophyllum commune
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCHCODRAFT_81883
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SCHCODRAFT_81883
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCHCODRAFT_81883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 510 aa AA seqDB search
MYGKRFVGSLDCGTTSVRFIVFNKYAEIVAQHQLEFPQYFPNPGWHDHDPEEILHAAEKC
IEEATAALERAGWTRDSIKAIGITNQRETTVAWSRSSGRPLCRAIVWTDSRTRNTATHYE
RLMDSELTGLPLSTYFSAIKLRWMIDHYPRVHVAHETDDLLFGTLESWLVYKLTAPRIHI
SDVSNAARTLLLDIQKLQWSPALLSFFRIRPSVLPKLVSSSEVYGTISSGPLAGVPIAGL
IGDQQGALVGNQCLTRGQAKCTYGTGAFLLFCTGEECITKGTGGLVSTIAYQAGPDAKPV
YALEGSIAVAGSAIKWLRDSMGLIQSSEEVNALAARVPDTGGLYFVTAFSGLLAPYWDPT
AAGLLIGLSQCTTPAHIARAALEAIAFQTRAILDTMRARSGMTLARALRVDGGVTNGDSA
MQVLGDIGGFAVERPEMRESTALGAALLAGAAVRLWGWDLGRPETLKEVNTAGSRVFEPK
MRKHVREAKWAGWNRAVERSKGWEETKDEE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtaaaaggttcgttggctcgctggattgtggcacaacttccgtccgcttcatt
gtcttcaacaagtacgccgagattgtggcgcagcaccagctggaatttccgcaatacttt
ccgaaccctgggtggcacgaccacgacccagaagaaatacttcatgccgcggaaaagtgc
atcgaggaggcgactgccgcgctggaaagggcaggctggactagggacagtattaaggct
ataggaattactaatcagcgcgagacaaccgtcgcatggagccgctcatcgggaaggccc
ctctgccgcgccatcgtttggacagactcgcggacgcggaatactgcgacgcattatgaa
cggctgatggacagtgagctcaccggcttaccattgtctacctacttctcggcgatcaag
ctgcgatggatgatcgaccactacccgcgggtacatgtcgcccacgagacggatgatctc
ctgttcggtaccctggagtcatggttggtctacaaactcaccgcgccccgtatacacatc
agcgacgtgtcgaacgcagcacggacacttctgctcgacattcagaagctccaatggtcg
cccgcgctcctgtccttcttccgcatccgcccctccgtgctgcccaagctcgtctcttcc
tcagaggtgtatggcaccatctcgtcaggaccactcgctggcgtgcccatcgctgggctc
atcggcgaccagcagggtgcgctcgtaggcaatcagtgcttgacgcgagggcaggcgaag
tgcacgtacggcacgggcgcgttcctgctgttctgcacgggcgaggaatgcatcacaaag
gggactggcgggcttgtgagcactatcgcctaccaagctgggccggacgcgaagccagtc
tatgccctcgagggcagcatcgccgtcgccggcagtgccatcaagtggcttcgcgactcc
atggggctcatccagtcctccgaagaggtcaacgccctcgccgcgcgcgtccccgacacc
ggcggcctctacttcgtcaccgccttctccgggctgctcgcgccgtactgggacccgacc
gccgccgggctcctcatcggcctctcgcaatgcaccacgcccgcccacatcgcccgcgcc
gcgctcgaggccatcgccttccagacgcgcgccatcctcgacaccatgcgcgcgcgctcg
ggcatgacgctcgcgcgcgcgctccgcgtcgacggcggcgtgacgaacggggactcggcg
atgcaggtgctgggcgatatcggcggcttcgcggtcgagcgcccggagatgcgcgagagc
acggcgctgggcgcggcgctgctggcgggggcggcggtgaggctgtgggggtgggatttg
gggcggccggagacgctgaaggaggtgaatacggcggggagcagggtgtttgagccgaag
atgcggaagcatgtgcgcgaggcgaagtgggcggggtggaatagggcggtggagaggagt
aagggttgggaagagacaaaggatgaggagtaa

DBGET integrated database retrieval system