KEGG   Schizophyllum commune: SCHCODRAFT_82322Help
Entry
SCHCODRAFT_82322  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scm  Schizophyllum commune
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:scm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:scm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:scm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:scm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:scm00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 816 aa AA seqDB search
MKIAVLTSGGDSAGMNAVVRAIVKAGILRGCETWIVREGYEGLVRGNTEYEELHGNTCYE
SPAPKLPVLPDIPADSKILANLRFGDGPLLRDGTADLASGRTLKGRYIVRAGWDDVRGWF
AEGGTLAGTARSQTFRTPEGRLQAAYNLIKEGIDALAVCGGDGSLTGADVFRSEWPSLVA
DLRSQGRITEEQAIKHGHLKIVGLVGSIDNDMSLTDLTIGAPTALARICEAIDNINSTAA
SHSRAFVLEVMGRHCGWLALQAALSGGADFLFIPERPPTVNPWEDEMCEAIKRHREIGKR
KTIVIVAEGAHDSDLNPIKAEYVKDVLTERLGLDTRVTTLGHTQRGGKPVAFDRILPTLQ
GVEAVEALLEANPNTPSYMIGIQENKITRVPLMEAVAMTRAVADAIKVKDFEKAMSYRDP
EFCDNLDGFHTVSELFKEKRLPPEKRMRIAIMHMGAPAGGMNAATRTAVRYCLRQGHTPI
GIHNGFPGLLDDDLLELSWLGVDNWVSRGGSELGTNRKLPDMDIGAVASKFQEYGFDAFM
MIGGFEAFSALLILDTNRKHYPAFNIPMVHLPATISNNVPMTEHSLGSDTSLNALVDACD
AIKQSASASRNRVFVVETQGGRCGYIATAGALATGASLVYTPEVGIGLDTLRRDVRYLKA
RYALDEKGKSEGRIVIRNEISSEVYTTDVITRMLKEEGGKLFDSRSASLGHTLQGGVPSP
MDRSRAVRLSLKSMAFLERYHELLRHTPRQLRHAPEESAAVITIQSSSIKWVPAQEMLLH
ADMHNRRGKTAWWTGLKDLAEALAGRPEFVKVKLPE
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcggtcctcacgtcgggcggcgacagcgccggcatgaacgccgtcgtccgc
gccatcgtcaaggctggcatcctcaggggatgcgagacatggatcgtgcgcgaggggtac
gagggcctcgtgcgcggaaacacggagtacgaagagctgcacggcaacacatgctacgag
agcccggcgccgaagctgccagtgctgcccgacattcccgcggacagcaagatcttggcc
aatcttcgctttggagatgggcccttgttgcgggatgggacggccgacttggctagcggg
cgaacgctgaagggtagatacatcgtccgcgcgggatgggatgatgtgcgcggatggttt
gcagagggcggcactctggccggaacggcgcgatcacagacattccgcacgcctgaaggt
cgtcttcaagctgcctacaacttgatcaaagagggaattgacgcccttgccgtttgcggt
ggagatggctctctcaccggcgcggacgtcttccgctccgaatggccctctctcgtcgcc
gaccttcgctcgcaaggcagaatcacggaggaacaggccatcaagcatggacacctcaag
atcgtcggtctcgttgggtctatcgacaacgacatgtccttgacggacttgactattggc
gcgcctacggctctggcgcgcatttgcgaggctatcgacaacatcaactcgacggctgct
agccactcgcgcgccttcgtgctcgaggttatgggcagacattgcggctggcttgccctg
caggcggctttgagcggaggcgccgacttcctcttcattcccgagcggccacctacagtc
aatccttgggaggatgagatgtgcgaagctatcaagcgtcaccgcgagatcggcaagcgc
aagaccatcgtcatcgtcgcggagggcgctcacgattccgatctgaaccccatcaaggcc
gagtacgtgaaggacgtcctcactgagcgccttggtctcgacacccgtgtcacgaccctc
gggcacactcagcgtggcggcaagccggtcgcattcgaccgtattctacccacattgcaa
ggcgtagaggccgtcgaggcgcttttggaggcgaacccgaacaccccgtcctacatgatc
ggcatccaggagaacaagatcacgcgcgttccgctcatggaggcggttgcgatgactcgc
gcagtggcggacgctatcaaggtcaaggactttgagaaggcgatgtcctaccgtgatccg
gagttctgcgacaaccttgacggttttcataccgtgtccgagttgttcaaggagaagcgt
ttgccgcctgagaagcggatgcgtatagctatcatgcacatgggtgctcccgctggtggc
atgaacgcggcaacgcgtaccgccgttcgctactgtttgagacaagggcacacccctatc
ggcatccacaacggcttcccgggtctgctcgacgatgatctgctcgaattatcgtggctc
ggcgtcgacaactgggtgtctcgtggcggctccgagctgggcacgaaccgcaagctgccc
gacatggacatcggcgccgtcgcgtccaaatttcaggagtatggcttcgacgcgttcatg
atgatcggcggcttcgaggccttctctgcgctgcttatcctcgacacgaaccgcaagcac
tacccggcgttcaacatccccatggttcatctgcccgcgacgatcagcaacaacgtgccg
atgacggagcacagtctgggcagcgacacgagtttgaacgcgctcgtggatgcgtgcgat
gccatcaagcaaagcgcaagcgcgagtcgcaaccgtgtgttcgttgtggagacgcagggt
ggcagatgcgggtatatcgcgacggcgggtgcgctggcgaccggtgcatcccttgtctac
acgcccgaggttggcattggccttgatactctgcgccgggatgtgcgttacctcaaggcg
cgctacgcgctcgatgagaaaggcaagagcgagggtcgcatcgtcatccgcaacgagatc
tcgtccgaagtctacactacggacgtcatcacgcgcatgctaaaggaggagggcggcaag
cttttcgactcgcgctccgcgtcgctcgggcacacgctccagggtggcgtgccctcgcca
atggaccgctcgcgtgcggtgcgcctctcgctgaagtcgatggcgttcctcgagcggtac
catgagttgttgaggcatacgccgaggcagctccgccacgcgccggaggagagcgcggcg
gtaatcacgatccagtcgagctcgatcaagtgggtgccggcgcaggagatgctgctgcac
gcggatatgcacaaccggagggggaagacggcgtggtggacggggctgaaggacctggcg
gaggcgctggccggtcgcccggagttcgtgaaggtcaagttgcccgagtaa

DBGET integrated database retrieval system