KEGG   Schizophyllum commune: SCHCODRAFT_82488Help
Entry
SCHCODRAFT_82488  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scm  Schizophyllum commune
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCHCODRAFT_82488
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCHCODRAFT_82488
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCHCODRAFT_82488
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCHCODRAFT_82488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 526 aa AA seqDB search
MKYFSTRGGKDLLSFEEAVLAGLAPDGGLYIPESIPSLPSDWQEAWKDYSFVDLSCAVLR
LYISPNEISNEDLRTLVEKSYSTFRHPAITPLHKLDDKRFILELFHGPTFAFKDVALQFL
GNLFEFFLLRRNAQKAEGEPQEKLTIVGATSGDTGSAAIYGVRNKANISVFILHPKGRVS
PIQEAQMTTVTDPNVHNVAVQGTFDDCQDIVKALFGDAEMNAKYKLGAVNSINWARILAQ
TVYYFHAYFNARKQLPADAELQFVVPTGNFGDILAGYYAKKMGLPMGKLAVATNANDILA
RFWRTGKYEKVDSAAASAPGEADPALGSSDGKQATAAGGVKETLSPAMDILVSSNFERLL
WYLAREGAEGATEEEKRANASATLAHWMSLVKTDGRVEVPVAALELARKDFVAERISDEQ
TLDTIKKHFLADQSYTADPHTAVGLAAAALIAAQNPQNTTQIILSTAHPAKFSEAVSRAL
KEYFEFDFERDVLPEEFRGLLDKPRNVIDVLKADVELLKDVIKKYA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttttcaacacgcgggggcaaggatttgctgtcctttgaggaggcagtcctc
gccggccttgccccggacggcggcctatacatcccagagtccatcccctcccttccctca
gattggcaagaagcatggaaagactactccttcgtcgatctatcctgcgccgtcctccgc
ctctacatctcgccgaacgagatctccaacgaggacctccgcaccctcgtcgaaaagtcc
tatagcacgttccgtcaccccgcgatcacccctctccacaagctcgacgacaagcggttt
atcctagagctcttccatggaccgacttttgcgttcaaggacgtcgcgctgcagtttctg
ggcaatctcttcgagttcttccttttgcggaggaatgcgcagaaggcggagggtgagccg
caggagaagctgacgatcgtgggcgcgacgagtggggatactgggagcgcagccatctac
ggtgtgaggaataaggccaacatctcggtcttcatcctccaccccaaggggcgcgtctcg
ccgattcaggaagcccaaatgactaccgtcacggatcccaacgtgcacaatgttgccgtc
cagggtacttttgatgactgccaggatattgtcaaagcgctcttcggcgacgcagaaatg
aacgcaaaatacaagctcggcgcggtcaactctatcaactgggcgcgcatcctcgcgcag
accgtctactacttccatgcttacttcaatgcacgcaagcaattacctgctgatgccgaa
ctccaattcgtcgtccccacaggcaactttggcgacatcctcgccggctactacgccaag
aagatggggctgccaatggggaagctcgcggtcgcgacgaacgcgaacgacatcctcgcg
cgcttctggcggacggggaagtatgagaaggtcgactcggctgctgcctcagcccctggt
gaggcagacccagcattaggctcgtcagacgggaagcaggcaaccgcggcgggcggagtg
aaggagacgttgagtccagcgatggatatcttggtgtcgagtaactttgagaggttgttg
tggtatttggcgagggagggggcggagggtgcgacggaagaagaaaagagggcgaatgcg
tcggcgacgttggcgcactggatgtcgctggtgaagacggacgggcgggtggaggtgccg
gtggcagcgctcgaactggcgaggaaggactttgtggcggagaggatatcggatgagcag
acattagataccatcaaaaagcacttcctcgcagaccagtcgtatacggcagacccgcat
actgcggttgggcttgctgctgcggcgctcattgcggcacaaaacccccaaaataccacc
cagataattctctccaccgcgcaccccgccaagttctccgaggccgtctctcgcgcgctc
aaggagtacttcgaatttgacttcgagcgcgatgtgctgccggaggagttccgggggtta
ctcgacaagccgcggaatgtcatcgatgtgctgaaggcggatgtggagctgttgaaggat
gtgatcaagaagtatgcgtag

DBGET integrated database retrieval system