KEGG   Schizophyllum commune: SCHCODRAFT_82488Help
Entry
SCHCODRAFT_82488  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scm  Schizophyllum commune
Pathway
scm00260  Glycine, serine and threonine metabolism
scm00750  Vitamin B6 metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01230  Biosynthesis of amino acids
Module
scm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCHCODRAFT_82488
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCHCODRAFT_82488
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCHCODRAFT_82488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 9587485
NCBI-ProteinID: XP_003030956
JGI: Schco1_82488
UniProt: D8Q7N7
Position
Unknown
AA seq 526 aa AA seqDB search
MKYFSTRGGKDLLSFEEAVLAGLAPDGGLYIPESIPSLPSDWQEAWKDYSFVDLSCAVLR
LYISPNEISNEDLRTLVEKSYSTFRHPAITPLHKLDDKRFILELFHGPTFAFKDVALQFL
GNLFEFFLLRRNAQKAEGEPQEKLTIVGATSGDTGSAAIYGVRNKANISVFILHPKGRVS
PIQEAQMTTVTDPNVHNVAVQGTFDDCQDIVKALFGDAEMNAKYKLGAVNSINWARILAQ
TVYYFHAYFNARKQLPADAELQFVVPTGNFGDILAGYYAKKMGLPMGKLAVATNANDILA
RFWRTGKYEKVDSAAASAPGEADPALGSSDGKQATAAGGVKETLSPAMDILVSSNFERLL
WYLAREGAEGATEEEKRANASATLAHWMSLVKTDGRVEVPVAALELARKDFVAERISDEQ
TLDTIKKHFLADQSYTADPHTAVGLAAAALIAAQNPQNTTQIILSTAHPAKFSEAVSRAL
KEYFEFDFERDVLPEEFRGLLDKPRNVIDVLKADVELLKDVIKKYA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttttcaacacgcgggggcaaggatttgctgtcctttgaggaggcagtcctc
gccggccttgccccggacggcggcctatacatcccagagtccatcccctcccttccctca
gattggcaagaagcatggaaagactactccttcgtcgatctatcctgcgccgtcctccgc
ctctacatctcgccgaacgagatctccaacgaggacctccgcaccctcgtcgaaaagtcc
tatagcacgttccgtcaccccgcgatcacccctctccacaagctcgacgacaagcggttt
atcctagagctcttccatggaccgacttttgcgttcaaggacgtcgcgctgcagtttctg
ggcaatctcttcgagttcttccttttgcggaggaatgcgcagaaggcggagggtgagccg
caggagaagctgacgatcgtgggcgcgacgagtggggatactgggagcgcagccatctac
ggtgtgaggaataaggccaacatctcggtcttcatcctccaccccaaggggcgcgtctcg
ccgattcaggaagcccaaatgactaccgtcacggatcccaacgtgcacaatgttgccgtc
cagggtacttttgatgactgccaggatattgtcaaagcgctcttcggcgacgcagaaatg
aacgcaaaatacaagctcggcgcggtcaactctatcaactgggcgcgcatcctcgcgcag
accgtctactacttccatgcttacttcaatgcacgcaagcaattacctgctgatgccgaa
ctccaattcgtcgtccccacaggcaactttggcgacatcctcgccggctactacgccaag
aagatggggctgccaatggggaagctcgcggtcgcgacgaacgcgaacgacatcctcgcg
cgcttctggcggacggggaagtatgagaaggtcgactcggctgctgcctcagcccctggt
gaggcagacccagcattaggctcgtcagacgggaagcaggcaaccgcggcgggcggagtg
aaggagacgttgagtccagcgatggatatcttggtgtcgagtaactttgagaggttgttg
tggtatttggcgagggagggggcggagggtgcgacggaagaagaaaagagggcgaatgcg
tcggcgacgttggcgcactggatgtcgctggtgaagacggacgggcgggtggaggtgccg
gtggcagcgctcgaactggcgaggaaggactttgtggcggagaggatatcggatgagcag
acattagataccatcaaaaagcacttcctcgcagaccagtcgtatacggcagacccgcat
actgcggttgggcttgctgctgcggcgctcattgcggcacaaaacccccaaaataccacc
cagataattctctccaccgcgcaccccgccaagttctccgaggccgtctctcgcgcgctc
aaggagtacttcgaatttgacttcgagcgcgatgtgctgccggaggagttccgggggtta
ctcgacaagccgcggaatgtcatcgatgtgctgaaggcggatgtggagctgttgaaggat
gtgatcaagaagtatgcgtag

DBGET integrated database retrieval system