KEGG   Schizophyllum commune: SCHCODRAFT_82692Help
Entry
SCHCODRAFT_82692  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
scm  Schizophyllum commune
Pathway
scm00620  Pyruvate metabolism
scm00630  Glyoxylate and dicarboxylate metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01200  Carbon metabolism
Module
scm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCHCODRAFT_82692
   00630 Glyoxylate and dicarboxylate metabolism
    SCHCODRAFT_82692
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCHCODRAFT_82692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 9588312
NCBI-ProteinID: XP_003030536
JGI: Schco1_82692
UniProt: D8Q9D5
Position
Unknown
AA seq 538 aa AA seqDB search
MTRVDIHSVQILSNAASDAQREILTEDALKFLSALHRTFESTRQNLLRAREDRQRKWDAG
APLDFPPETAHIRAEPSWHCAPPAPGLEDRRTEITGPTDRKMVINALNSGAKTFMADFED
SNAPTFANMVNGQLNLRDAIRRQIDFDSNGKAYKLSQNPAVLIVRPRGWHLDEPRVTVDG
APVSGSIFDFALYFFHNAKELVQRGTGPYFYLPKMEHYLEARLWNDIFNFSQSYVGLPHG
TVRATVLIETIPAAFHMEEILFELRQHSSGLNCGRFIKKRRADASAVLPNRSDVTMTVPF
MDAYVRLLIQTCHKRKVAAMGGMAAQIPIKDDPKANDEAMAKVKADKLREVLAGHDGTWI
AHPLINKIAREAFDSHMLGPNQYHVLREDVKVTASNLLDTKVPGKITDAGVRSNVATCLA
YTASWIGGNGCIPLNYLMEDAATAEITRIQLWQWVHYSSRLDTGEIVTAPYVEQLIDEIA
PTVSKIAPAVKEKELQVTVQYLKSQIKATWPSEFLTSDLMPYLAAADGVDAKFLKAAL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagtcgacatacacagcgtacagatcctttctaacgctgcgtccgacgctcag
cgcgagatcctcaccgaggacgcgctcaagttcctctctgccctccaccgtaccttcgag
agcacccgccagaacctcttgcgcgctcgcgaggaccgccagcgtaagtgggatgctggc
gcgccgctcgacttccctcccgagaccgcgcacatccgtgctgagccatcgtggcactgc
gcgccacccgcgcctggacttgaggatcgccgtacggagattactggtcccactgaccgc
aagatggtcatcaacgccctcaacagcggggctaagaccttcatggccgacttcgaggat
tcgaacgcaccgacgttcgccaacatggtgaacggccagctcaacctgcgcgacgccatc
cgccgccagatcgacttcgactcgaatggcaaggcgtacaagctgagccagaacccggcc
gtcctcatcgtccgaccccgtggctggcaccttgacgagccccgcgtgactgtcgatgga
gcgcctgtttccggttccatcttcgacttcgccctgtacttcttccacaatgccaaggag
cttgttcagcggggcacgggaccgtacttctacttgccgaagatggagcactatctggag
gcgcgcctatggaacgacatcttcaacttctcgcagtcgtacgttggcttgccgcacggc
accgtccgcgccacggtcctcatagaaactattccggccgccttccacatggaagagatc
ctcttcgagttgaggcagcattcatctggtctcaactgtggacgcttcatcaagaagcgg
agagcagatgccagcgctgtccttcccaaccgctccgatgtgaccatgacggttcccttc
atggacgcctacgtgcgtctgctcatccagacctgccacaagcgcaaagttgctgctatg
ggtggaatggctgctcagatccccatcaaggacgacccgaaggcgaacgacgaggcgatg
gcgaaggtcaaggcggacaaattgcgcgaagtacttgcaggacacgacggtacttggatt
gcccacccgctcatcaacaagatcgcccgggaggccttcgactctcacatgctgggcccg
aatcagtaccacgtcttgcgcgaggacgtcaaggtcaccgccagcaacttgctcgacacc
aaggtgccaggcaagatcaccgacgccggcgtccgctccaacgtcgccacctgccttgcc
tacaccgcgtcctggatcggcggcaacggctgcatcccgctcaactacctcatggaggac
gctgccacagcggagatcacgcgcattcagctctggcagtgggtgcactactcctcgcgc
ctcgacaccggcgagatcgtcaccgcgccgtacgtcgagcagctcatcgacgagatcgcg
ccgacggtgagcaagatcgcgcccgcggtgaaggagaaggagttgcaggtcaccgtccag
tacttgaagtcgcagatcaaggccacctggccgagcgagttcttgacctcggacttgatg
ccgtatctggcggcggcggacggtgtggatgcgaagttcttgaaggcagcgctatag

DBGET integrated database retrieval system