KEGG   Schizophyllum commune: SCHCODRAFT_82727Help
Entry
SCHCODRAFT_82727  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
scm  Schizophyllum commune
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SCHCODRAFT_82727
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SCHCODRAFT_82727
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SCHCODRAFT_82727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 420 aa AA seqDB search
MQRHTFTALNSTFVVDSEYQFVKELGQGAYGCVVAARHRRTGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYSSGTGSAS
NNQGFMTEYVATRWYRAPEVMLSFANYTTAIDVWSIGCILAELLGGKPIFKGRDYVDQLN
QILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFATLFPHANPLAIDLLSKMLCFDP
AKRISCEQALNHPYFQVWHDPADEPICEAKFDFGFEEEDSIEGMKKLIIEEVKQFRAEVR
AQARAAGQIQRSGSNLGIPSRDEIMNSPVAENYNGQEVPRSQSPVMEDPSAALERELAGK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccatacgtttaccgcgctcaattcgacgttcgtcgtcgactcggagtaccaa
ttcgtgaaggagctggggcagggcgcgtatgggtgcgtcgtcgctgcgcgacaccgccgc
actggggagggatgtgcgatcaagaagatcacaaacatcaacaccaagcgcatcctgacg
aagcgatgcttgcgagaaattcgcctcctgcaccacttccgcgggcacaagaacattacc
tgcctgtacgacatggacatcgtcttccagccgaacggcaactttgacgaagtctacctc
tatgaagagctcatggaggccgatctgcacgctatcatccgttccggccagcccctcacc
gacgcccacttccagtccttcctgtaccagacgctctgcggcctgaagtacatacactcc
gccaacgtcctccaccgcgacctcaagcccggcaacctgctcgtcaatgccgactgcgag
ctgaagatctgtgactttggccttgcgcgcgggtacagctcgggcacgggcagcgcgtcg
aacaaccagggcttcatgaccgagtacgtcgcaactcggtggtaccgcgcgccggaggtc
atgttgagctttgcaaactacacgacggcgattgacgtctggtctattggctgtattctg
gctgagttgttgggcggaaagccgatattcaagggccgggactacgtcgatcaattgaac
cagatccttcactacctcggcacgccatccgaagacacccttcgtcgcgtcggctcacca
agggcccaagactacatccgctccctccccatcaagccccgcgtccctttcgccaccctc
ttcccccacgccaaccccctcgccatcgacctgctctccaagatgctctgcttcgacccg
gcaaagcgcatctcctgcgagcaggcgctcaaccacccctacttccaggtctggcacgac
cccgcggacgagcccatctgcgaggccaagttcgacttcggcttcgaggaggaggacagc
atcgagggcatgaagaagctgatcatcgaggaggtgaagcagttccgcgcggaggttcgg
gcgcaggcgcgcgcggcggggcagatccagcggtcggggagtaacctgggcatcccctcg
cgcgacgagattatgaactcgcccgtggcggagaactacaatggacaggaggttccgcgg
tcgcagagcccggtcatggaggacccgagcgcggcgctcgagcgtgagctagctggcaag
taa

DBGET integrated database retrieval system