KEGG   Schizophyllum commune: SCHCODRAFT_82727Help
Entry
SCHCODRAFT_82727  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
Organism
scm  Schizophyllum commune
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase WD40 APH Kdo
Motif
Other DBs
NCBI-GeneID: 9591579
NCBI-ProteinID: XP_003030159
JGI: Schco1_82727
UniProt: D8Q9N1
Position
Unknown
AA seq 420 aa AA seqDB search
MQRHTFTALNSTFVVDSEYQFVKELGQGAYGCVVAARHRRTGEGCAIKKITNINTKRILT
KRCLREIRLLHHFRGHKNITCLYDMDIVFQPNGNFDEVYLYEELMEADLHAIIRSGQPLT
DAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGYSSGTGSAS
NNQGFMTEYVATRWYRAPEVMLSFANYTTAIDVWSIGCILAELLGGKPIFKGRDYVDQLN
QILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFATLFPHANPLAIDLLSKMLCFDP
AKRISCEQALNHPYFQVWHDPADEPICEAKFDFGFEEEDSIEGMKKLIIEEVKQFRAEVR
AQARAAGQIQRSGSNLGIPSRDEIMNSPVAENYNGQEVPRSQSPVMEDPSAALERELAGK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccatacgtttaccgcgctcaattcgacgttcgtcgtcgactcggagtaccaa
ttcgtgaaggagctggggcagggcgcgtatgggtgcgtcgtcgctgcgcgacaccgccgc
actggggagggatgtgcgatcaagaagatcacaaacatcaacaccaagcgcatcctgacg
aagcgatgcttgcgagaaattcgcctcctgcaccacttccgcgggcacaagaacattacc
tgcctgtacgacatggacatcgtcttccagccgaacggcaactttgacgaagtctacctc
tatgaagagctcatggaggccgatctgcacgctatcatccgttccggccagcccctcacc
gacgcccacttccagtccttcctgtaccagacgctctgcggcctgaagtacatacactcc
gccaacgtcctccaccgcgacctcaagcccggcaacctgctcgtcaatgccgactgcgag
ctgaagatctgtgactttggccttgcgcgcgggtacagctcgggcacgggcagcgcgtcg
aacaaccagggcttcatgaccgagtacgtcgcaactcggtggtaccgcgcgccggaggtc
atgttgagctttgcaaactacacgacggcgattgacgtctggtctattggctgtattctg
gctgagttgttgggcggaaagccgatattcaagggccgggactacgtcgatcaattgaac
cagatccttcactacctcggcacgccatccgaagacacccttcgtcgcgtcggctcacca
agggcccaagactacatccgctccctccccatcaagccccgcgtccctttcgccaccctc
ttcccccacgccaaccccctcgccatcgacctgctctccaagatgctctgcttcgacccg
gcaaagcgcatctcctgcgagcaggcgctcaaccacccctacttccaggtctggcacgac
cccgcggacgagcccatctgcgaggccaagttcgacttcggcttcgaggaggaggacagc
atcgagggcatgaagaagctgatcatcgaggaggtgaagcagttccgcgcggaggttcgg
gcgcaggcgcgcgcggcggggcagatccagcggtcggggagtaacctgggcatcccctcg
cgcgacgagattatgaactcgcccgtggcggagaactacaatggacaggaggttccgcgg
tcgcagagcccggtcatggaggacccgagcgcggcgctcgagcgtgagctagctggcaag
taa

DBGET integrated database retrieval system