KEGG   Schizophyllum commune: SCHCODRAFT_84347Help
Entry
SCHCODRAFT_84347  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 408 aa AA seqDB search
MRGLLTALEPLLERDVALGEGSFPGLNDSDAPTSAKESSTPVLDATIRLLKEFLPSGKGK
ERAVEGAVANGDASGWSRVGKSGLEEEEEREAFTPTFVYDALMKKRRFGHLKLGQQEDAE
EFLGFYLDELEEELESLLKDSQEDQQGGHSGEAEGWTEVGKGKAKNAVVRGSGPLHNSPI
SRIFGGTFRSTLKQPKKPDSVTVERWQRLMLDVEHESIDTIEDAIQRLVQPQTISDPASP
TSQGPMMLQLQIASLPPVLVLHLKRFFYSADEVKKVSKEVRYGPILEFPANSNVLAKRTA
AAKYRLFAVLYHHGRSAAGGHYTLDVLCPTRFALPAAQASKPAPPKAAPGVAVSKPGPRF
REGWIRIDDELVSDIRPEDVFGPGSRSGGRWEEEGGRCAYLLFYERIG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggttgctcaccgcgctcgaacccttgcttgagcgcgacgtggcgctgggcgag
ggttcgttcccgggtctcaatgacagcgatgcgcctaccagcgcgaaggagagttcgacg
ccggtgctggacgcgacgatccgcttgctgaaggagttcttgccaagtggaaaggggaag
gagcgcgcggtggagggtgcagtggcgaatggcgatgcttcgggctggtcgagggtgggg
aagtcagggttggaggaagaggaggaacgcgaggcgtttacgccgacgtttgtgtacgat
gcattgatgaagaagaggcggttcggccatcttaagcttggtcaacaggaggacgcggaa
gagttcctcgggttctatcttgatgagttggaggaggaactcgaaagcttgctgaaggac
tcgcaagaggatcagcaaggtgggcactccggtgaggccgaaggttggactgaggtcggc
aagggcaaagcgaagaacgctgtcgttcgtggctcgggtcccttgcacaactcgccgatc
tccaggatctttggaggtactttccgctcgacgttgaagcagccaaagaagcccgactcc
gttacggtcgagcgctggcagcgccttatgctggatgttgagcacgagtctattgatacc
atcgaggacgccatccagaggctggtgcagccgcagaccatctccgatcccgcgtctcca
acttcgcaaggcccgatgatgttgcaactgcagatcgcgtcgttacctccggtgcttgtg
ctgcacctgaagcgcttcttctactccgccgacgaggtcaagaaggtcagcaaggaggtg
cggtatgggcctatcttggagttcccggccaacagcaacgtccttgcgaagcgcacggcg
gcggccaagtacaggctcttcgcggttctgtaccatcacggccgctctgcggctggtggt
cactacacgctcgacgtgttgtgtccgacccgcttcgctcttcccgcagcgcaagctagc
aagcctgctccgccaaaggcagcgcccggtgtcgctgttagcaagccgggtccgcgtttc
cgcgagggctggatccgcatcgacgacgaactcgtgtctgacatccgtcccgaggacgtt
ttcggccctggctctcggtcgggcgggcgctgggaggaagaaggcggccgatgcgcgtat
ctgctcttttacgagcgcattggctga

DBGET integrated database retrieval system