KEGG   Schizophyllum commune: SCHCODRAFT_84479Help
Entry
SCHCODRAFT_84479  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scm  Schizophyllum commune
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCHCODRAFT_84479
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_84479
  Amino acid metabolism
   00310 Lysine degradation
    SCHCODRAFT_84479
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCHCODRAFT_84479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 439 aa AA seqDB search
MFSQRVIIPARTRSLASTACTSALTAGWKVAGRAPRALFHSSRLLQATTVKVPQMAESLT
EGTLKTWLKQPGEAVAADEEIATIETDKIDVPVNAPAAGKLVEHLANEEDTVTVGQDLFV
IEEGAEGEAAPAKDNQPESSAESEKPASDAAPPPQDQAAQKPAPSPSSPSDAASKSASPP
SKEERSAAPVKKAQPASESKGPAPTTSSRGETRVKMSRMRLRIAERLKESQNAAASLTTF
NEIDMSSLMEMRSKYKDAVLKEHDVKLGFMSAFAKASTLALKEIPAANASIEGDEIVYRD
YVDLSVAVATPKGLVTPVVRNAESLGFVDIEKEIAALGKKARDGKLTLEDMSGGTFTISN
GGVFGSLFGTPIINLPQAAVLGMHAIKDKPVVVNGQIVVRPIMVIALTYDHRLLDGREAV
TFLVRVKEYIEDPRKMLLA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttctcccagcgcgtgatcatacctgcccggacgcgcagccttgctagcactgcgtgc
acatctgctttgacagccggatggaaggttgccggccgtgctcctcgcgctctatttcat
tcatcccggctccttcaagccacgacggtcaaagttcctcagatggcggagtccctgaca
gagggaacattgaagacttggctcaagcagcctggcgaggccgtggccgcagatgaagaa
atcgcgactatcgagacggacaagattgacgtacccgtcaatgctccagcagccgggaag
ctggttgagcacctagctaatgaggaagacaccgtcactgtggggcaggacctcttcgtg
atagaagagggcgctgagggcgaagcggctcccgccaaagacaatcaacccgagtccagc
gctgaatctgagaagcctgcgtccgatgctgcacccccgcctcaagatcaagcggctcag
aagcctgcgccgtcgccttcgtccccaagcgatgccgcgtccaagtccgcttcgccacca
tccaaggaagagcgctctgcagcacccgtcaagaaggctcaacccgcatctgagtctaag
ggccctgcaccaacgacctcgtcccgtggcgagacacgagttaagatgtctcgtatgcga
cttcggatagcggaacgtttgaaggaatctcagaatgctgccgcctcgctcaccacattc
aacgaaatcgacatgtcatctctcatggagatgcgttccaaatacaaagacgctgttctg
aaggaacatgacgtgaaacttgggtttatgagcgcgttcgccaaggccagcacccttgcg
ctgaaggaaatccccgctgccaatgcatctatcgaaggcgatgagatcgtgtatcgcgac
tacgtcgatctgagcgttgcggtggcgactcccaagggacttgtgacgcccgtggtgcgc
aacgcagagagccttggctttgtcgacattgagaaggagattgcggccctcggcaagaag
gcgcgtgacgggaagctcacattggaagacatgtcgggaggcacattcaccatttccaat
ggtggtgtctttggatcgctcttcggcacgccgatcatcaacctgccacaagcagcagta
ctcggtatgcatgctatcaaggataagcctgtggtcgtcaatgggcagatcgtggttcgc
ccgatcatggtcattgctttgacgtacgatcatcgtctgctggacggtcgcgaagctgtt
accttcctcgtgcgcgtgaaggagtacatcgaggatcctcggaagatgctcctggcatga

DBGET integrated database retrieval system