KEGG   Schizophyllum commune: SCHCODRAFT_84479Help
Entry
SCHCODRAFT_84479  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scm  Schizophyllum commune
Pathway
scm00020  Citrate cycle (TCA cycle)
scm00310  Lysine degradation
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
Module
scm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_84479
  Amino acid metabolism
   00310 Lysine degradation
    SCHCODRAFT_84479
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCHCODRAFT_84479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 9595691
NCBI-ProteinID: XP_003035091
JGI: Schco1_84479
UniProt: D8PWC4
Position
Unknown
AA seq 439 aa AA seqDB search
MFSQRVIIPARTRSLASTACTSALTAGWKVAGRAPRALFHSSRLLQATTVKVPQMAESLT
EGTLKTWLKQPGEAVAADEEIATIETDKIDVPVNAPAAGKLVEHLANEEDTVTVGQDLFV
IEEGAEGEAAPAKDNQPESSAESEKPASDAAPPPQDQAAQKPAPSPSSPSDAASKSASPP
SKEERSAAPVKKAQPASESKGPAPTTSSRGETRVKMSRMRLRIAERLKESQNAAASLTTF
NEIDMSSLMEMRSKYKDAVLKEHDVKLGFMSAFAKASTLALKEIPAANASIEGDEIVYRD
YVDLSVAVATPKGLVTPVVRNAESLGFVDIEKEIAALGKKARDGKLTLEDMSGGTFTISN
GGVFGSLFGTPIINLPQAAVLGMHAIKDKPVVVNGQIVVRPIMVIALTYDHRLLDGREAV
TFLVRVKEYIEDPRKMLLA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttctcccagcgcgtgatcatacctgcccggacgcgcagccttgctagcactgcgtgc
acatctgctttgacagccggatggaaggttgccggccgtgctcctcgcgctctatttcat
tcatcccggctccttcaagccacgacggtcaaagttcctcagatggcggagtccctgaca
gagggaacattgaagacttggctcaagcagcctggcgaggccgtggccgcagatgaagaa
atcgcgactatcgagacggacaagattgacgtacccgtcaatgctccagcagccgggaag
ctggttgagcacctagctaatgaggaagacaccgtcactgtggggcaggacctcttcgtg
atagaagagggcgctgagggcgaagcggctcccgccaaagacaatcaacccgagtccagc
gctgaatctgagaagcctgcgtccgatgctgcacccccgcctcaagatcaagcggctcag
aagcctgcgccgtcgccttcgtccccaagcgatgccgcgtccaagtccgcttcgccacca
tccaaggaagagcgctctgcagcacccgtcaagaaggctcaacccgcatctgagtctaag
ggccctgcaccaacgacctcgtcccgtggcgagacacgagttaagatgtctcgtatgcga
cttcggatagcggaacgtttgaaggaatctcagaatgctgccgcctcgctcaccacattc
aacgaaatcgacatgtcatctctcatggagatgcgttccaaatacaaagacgctgttctg
aaggaacatgacgtgaaacttgggtttatgagcgcgttcgccaaggccagcacccttgcg
ctgaaggaaatccccgctgccaatgcatctatcgaaggcgatgagatcgtgtatcgcgac
tacgtcgatctgagcgttgcggtggcgactcccaagggacttgtgacgcccgtggtgcgc
aacgcagagagccttggctttgtcgacattgagaaggagattgcggccctcggcaagaag
gcgcgtgacgggaagctcacattggaagacatgtcgggaggcacattcaccatttccaat
ggtggtgtctttggatcgctcttcggcacgccgatcatcaacctgccacaagcagcagta
ctcggtatgcatgctatcaaggataagcctgtggtcgtcaatgggcagatcgtggttcgc
ccgatcatggtcattgctttgacgtacgatcatcgtctgctggacggtcgcgaagctgtt
accttcctcgtgcgcgtgaaggagtacatcgaggatcctcggaagatgctcctggcatga

DBGET integrated database retrieval system