KEGG   Schizophyllum commune: SCHCODRAFT_84511Help
Entry
SCHCODRAFT_84511  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
scm  Schizophyllum commune
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SCHCODRAFT_84511
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SCHCODRAFT_84511
   04113 Meiosis - yeast
    SCHCODRAFT_84511
Protein phosphatases and associated proteins [BR:scm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SCHCODRAFT_84511
Ubiquitin system [BR:scm04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SCHCODRAFT_84511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 289 aa AA seqDB search
MAGKAHYERQNYAAAERAFGAVRTLEPYRLWDMEIYSSLLWNVRKAEELSYLAQELLNIN
PHAPQGWLAAGNLFSLQRDRAKALACFRRAFQLDPSCAYAYTLSGQELLDEDADRAINFF
QSALRVDARHYNAWYGLGTCYMRMSKIRMAEFHFRKAVEINPKNAVLLGCLGMAVERRND
RPGGLKLFNEAVELQPDNALVRYRRAKIYIAMRRYEDAISDLEFLRNTSPEEANVVFQLA
KAYRLAGQEVKALHMVAVARDIAPKSVNRIRKLLELNKDEDEDNRMDEG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaaggcgcattacgagcgacagaattacgctgcagcagaacgcgcgttcggg
gcagtacgtacgctggagccctaccggttgtgggacatggagatatactcgtcgctgctc
tggaacgtccggaaagcggaggagctgtcgtacctagcgcaggagctcctcaacatcaac
ccgcatgcacctcaaggctggttagccgctgggaatctcttctcgctgcaacgggaccgg
gcaaaagccctggcgtgctttcgacgggcgttccaacttgaccccagttgcgcttacgcg
tacacgctcagtgggcaggagttgctggatgaggatgctgaccgagctatcaacttcttc
caatccgctcttcgcgtcgacgcacgacactacaacgcttggtatggcctcgggacgtgc
tatatgcgcatgagcaagatacggatggcagaatttcattttcggaaggcggtcgagatc
aacccgaagaacgctgttttgctaggctgcctgggaatggcggtagagcgacggaacgat
cgccccgggggcctcaagctgttcaatgaggccgtggagctgcagcctgataatgcgctc
gtgcgctatcggcgggcgaagatatacattgcaatgcggcggtacgaggatgcgatcagc
gacctggagttcctccgcaacacgtcgccggaggaggcgaatgtggtgttccagctcgcg
aaggcttatcggctggcggggcaggaggtgaaggcgctgcatatggtcgccgtcgcgcgg
gatatcgcgccgaagagcgtcaaccggattcggaagctgctggagctcaacaaggacgag
gatgaggacaaccggatggacgagggctga

DBGET integrated database retrieval system