KEGG   Schizophyllum commune: SCHCODRAFT_85095Help
Entry
SCHCODRAFT_85095  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scm  Schizophyllum commune
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCHCODRAFT_85095
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCHCODRAFT_85095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 396 aa AA seqDB search
MKLLLVLVSAAISSHVAFAHEGASHDQVPFDYNLFPYQMPAYRAANGEVTADSIFSGITT
FARLPWVQCLGKDAHEKFDIAFLGAPFDTGTSYRPGARFGPSGIRAGSRRLNLYGGYNVP
MEVNPFTSLRMVDCGDIPVTPYDNTYAIKQIEEGHKAILKREAFSPLGNDSVTGMALEPF
SRDGKSHPRIITLGGDHTIVLPLLRSINSVYGAISVVHFDSHLGDWKPQVFGGAPSEVAA
INHGTYFWHAAQEGLIKNGTSIHGAIRTTLSGLEDYEVDDAVGFHRIEAREIDTLGIDGI
VKKIRDTVGDNPVYLSIDIDSIDPAFAPGTGTPETGGWSTRELRTIIRGLDGLKIVSADV
VEVAPAYDTNAELTTMAAADVLYEVVSAMAKTPLGK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcctcctcgtcctcgtctctgctgctatctcgtcgcatgtcgcgttcgcgcat
gagggcgcctcgcacgaccaggtccccttcgactacaacctcttcccttaccagatgccc
gcgtaccgcgcggcgaatggtgaagttaccgccgactccatcttttccggtatcactacc
ttcgcccgcctaccttgggtgcaatgcctcgggaaggatgctcacgagaagttcgacatc
gccttcttgggtgcgccctttgacaccggcacctcataccgtccgggcgcgcgctttgga
ccttcgggcattcgtgcgggttcgcgtcgcctcaatttgtacggaggctacaacgtcccc
atggaggtcaaccccttcacgagcctgcgcatggttgactgcggcgacatcccagtgacg
ccgtacgataacacatacgcgatcaagcagatcgaagaaggccacaaggccatcctcaag
cgcgaggccttctctcctctgggcaatgactcggtgacgggcatggcgctcgagcccttt
tcccgcgatgggaaatcgcaccctcgcatcatcacattgggtggcgaccacaccatcgtc
ctgccgctcctgcgctcgattaactccgtctacggcgctatcagcgtcgttcacttcgac
tcacatcttggtgattggaagccgcaggtcttcggcggtgcaccgtccgaagtagctgct
atcaaccacggcacatatttctggcacgccgcgcaggagggtcttatcaagaacggcacg
tcaattcacggcgccatccgcacgaccctctccggcctcgaggactacgaagtcgacgac
gctgtcggcttccaccgcatcgaggctcgcgagatcgataccctcggcatcgacggcatc
gtgaagaaaatccgtgacaccgtcggcgacaaccccgtctacctgtccatcgacattgac
tccattgacccggctttcgcgcctggtaccggcacgcctgagactggcggctggtcgacg
cgcgagctgcgcactatcatccgtggtcttgacggtctgaagatcgtctctgccgatgtc
gttgaggtcgcgcctgcgtacgacacgaatgccgaactcacgactatggcagcggctgac
gttctctacgaggtcgtcagcgcgatggccaagaccccgctgggtaagtaa

DBGET integrated database retrieval system