KEGG   Schizophyllum commune: SCHCODRAFT_85197Help
Entry
SCHCODRAFT_85197  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
scm  Schizophyllum commune
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCHCODRAFT_85197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 107 aa AA seqDB search
MPFTPGDASKGASLFKTRCAQCHTVGAGEPHKVGPNLHGVFGRKTGQADGYSYTAANVSK
GITWDENTMFEYLENPKKYIPGTKMAFAGLKKDKDRDNLITWLKENC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcactcccggtgacgcctccaagggtgcttccctcttcaagacccgctgcgcg
cagtgccacactgtcggcgcgggcgagccccacaaggtcggccccaaccttcacggtgtc
ttcggtcgtaagaccggtcaggccgacggctactcctacaccgctgccaacgtgagcaag
ggcatcacctgggatgagaacactatgttcgagtacctcgagaacccgaagaagtacatt
ccgggaaccaagatggcgttcgccggcttgaagaaggacaaggaccgggacaacctcatc
acctggctcaaggagaactgctaa

DBGET integrated database retrieval system