KEGG   Schizophyllum commune: SCHCODRAFT_85551Help
Entry
SCHCODRAFT_85551  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 324 aa AA seqDB search
MSGDEDSNGWQLTESDPGVFSELLKNLGVPLIVDDLYTLDPESLATLQPLHALIFLFKWV
PTSDPSSSTAGEYDRDFPGFFAHQVVNNACATLAVLNALGNIPGLPTGPELAELNNFTTG
MDPQTRGLVITSADWLREAHNKLSPPNVISLDGLGLPKTTEDAYHFVVYVPVLGNLYELD
GLKQFPVRHGPYDESGEGWVKKAREVIEARIATYPPGALEFSLLALRDDPLPALQSRLQE
LQAAGRDGEAAEVTMKLADEQAKRERWAFENSLRKHNHVGLMHALLIALAKAGRLSPAQE
KARQLMKERIEKRRAKGDHGMDED
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgacgaagactctaacgggtggcaactaacggaatccgatcccggtgttttc
agcgagttgttgaagaacctgggggtccctctgatagtggacgacctatacacgctcgat
cccgaatcactggcgactctacagcctctacacgccttgatctttctctttaaatgggtt
cctacttcggatccctcatcctccactgctggcgagtatgacagggacttccctggcttc
ttcgcgcaccaggtcgtcaacaatgcgtgcgccacactggcagttctgaacgctcttggc
aacatccccgggctgcccacggggcccgaactggcagaactgaacaacttcaccacgggg
atggacccacaaacccgagggctcgtaatcactagcgccgactggctgcgcgaggctcac
aacaagctgtccccacccaacgtcatctccctcgatggactcggcctaccgaagactacc
gaggacgcctaccacttcgtcgtctacgtgccggttctagggaacctctatgaactggac
ggcttgaagcaattccccgtccgtcacggcccgtatgacgagagcggtgaagggtgggtg
aagaaggcaagggaggtaatagaagcgcggatcgctacttaccctccgggcgcgttggag
ttcagccttctcgcgctgcgagatgaccctcttcctgcgctgcaatcgcgcttgcaggaa
ctgcaggcagccgggcgggacggcgaagcagccgaagtgacgatgaagctcgccgacgag
caggcgaagcgcgagcgctgggctttcgagaacagcttgcggaagcacaatcacgtcggc
ttaatgcacgctctactgatcgccctcgcgaaggctgggaggctgtctcccgcgcaggag
aaggcgaggcagctgatgaaggagcgaattgagaagaggagggcaaagggcgaccacggg
atggacgaagattag

DBGET integrated database retrieval system