KEGG   Schizophyllum commune: SCHCODRAFT_85712Help
Entry
SCHCODRAFT_85712  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SCHCODRAFT_85712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 377 aa AA seqDB search
MSQAFARLRQPLRAASRQIARPSTRNATPTFRASFRRFNSTEAPKPPKSNTGLYAGIAGG
ALLAGIGFYYYSQGMNPLTAAKSGAQAAKVATNFVPSKEDYQKVYNRIAELLDEAEDYDD
GSYGPVVLRLAWHSSGTYDKDTNTGGSNYATMRFEPEALHGANAGLHVARELMEKVKQEF
PWISYGDLWTLGGVAAVQEMGGPKIPWRPGRVDGTAEKATPDGRLPDASQGADHLRNIFY
RMGFNDQEIVALSGAHALGRCHRDRSGFEGPWTFSPITLTNDYFRLLFDETWVWRKWDGP
KQLQDKSTRSLMMLPTDYVLVQDKSFKKYAKQYADDQDLFFKDFANVVSRLFELGVPSEQ
FVTKEPWIMKNADEKDE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggcttttgcgcgcctccgccagccactccgcgctgcgtcccgccagatcgcg
cgcccctcgacgcggaatgcgacccctactttccgagcgtcattcaggcgcttcaactcg
acggaggcgcccaagcctcccaagtccaacaccgggctttatgcgggaatcgctggcggt
gccctgctggctgggatcggtttctactactattcgcagggaatgaacccgctgacggcg
gccaagtcgggggcgcaggctgccaaagttgcgaccaacttcgtcccttcgaaggaggat
tatcagaaggtttacaaccgaatcgctgagctccttgatgaagcggaggactacgatgac
ggctcatacggtcccgttgtccttcgtctcgcttggcactcctcggggacgtacgataag
gacacgaacacgggcggcagcaactatgccaccatgcgcttcgagcctgaggctctccac
ggggcgaacgcgggccttcacgttgcgcgcgagctcatggagaaggtcaagcaggagttc
ccctggatcagctatggggacctctggacgctcggtggtgtcgctgcggtgcaggaaatg
ggcggcccgaaaatcccctggaggcctggtcgcgtcgacggaacggctgagaaggcgact
cctgatggccgtctcccagacgcctcccagggagctgaccacctgcgcaacatcttctac
cgcatgggcttcaacgaccaggaaattgtcgcgctctcgggtgctcacgcgcttggccgc
tgccaccgtgaccggtctggattcgagggtccctggactttctcgcccatcaccctcacg
aacgactacttccgccttctctttgacgagacgtgggtctggaggaagtgggatggcccc
aagcagcttcaggacaagtccactcgctcgcttatgatgcttccgacggactatgtcctc
gtgcaggacaagagcttcaagaagtacgcgaagcagtacgcggacgatcaggacctgttc
ttcaaggacttcgccaatgtcgtctcgcgtctcttcgagctcggcgtgccgtctgagcag
ttcgtgaccaaggagccttggatcatgaagaacgcggacgagaaggacgagtag

DBGET integrated database retrieval system