KEGG   Solitalea canadensis: Solca_0452Help
Entry
Solca_0452        CDS       T02084                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scn  Solitalea canadensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559839..561848
Genome map
AA seq 669 aa AA seqDB search
MHYSPSVLLYSRFSDFDIGLFKAGKHFRLYDKLGSHVVEHEGTTGTYFAVWAPNADAVSV
IGNFNGWNNEAHYLGARWDGSGIWEGFIPNIGQGEAYKYFIRSNSGGYFERADPYALYCE
EPPRTASIVWNTWYEWQDQEWMNRRPQFNALDKPISVYEVHLASWRRDPSNPDRFLSYRE
LARDLVEYVTHMGFTHVEFMPVMEHPFLGSWGYQVTGYFAPTSRFGSPQDFMFLIESLHR
AGIGVYLDWVPSHFPGDAHGLYNYDGSHLYEHADPRQGFHPDWSSYIFNYGRNEVRSFLI
SNALFWFDRYHADGLRVDAVASMLYLDYSRKEGEWVPNQYGGRENLDAVSFLKELNEVAY
GNYGDIQMIAEESTSWPGVSHPTWQGGLGFGMKWMMGWMNDTLRYFAKEPIYRRYHQQEL
TFSTVYAFTENFMLPLSHDEVVHGKGALVSKMPGDEWQRFANLRLLYAFMYTHPGTKLLF
MGGEFGQTSEWSHDYSLDWHLTQYEPHKGVENMMCDLNRLYKNEPALYDFNFAGYGFEWI
DQSDSENCVLVYCRKGHHWQEYVVVVANLTPVARHDYRIGLPHNGTWSEIFNSDKHDYWG
SGVVNHYPKEAEMESWQGKAQSISISLPPSGITVWKLKEHPDVSNSNYSENNIKEEKKKK
APKGLSDGK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcattattctccttccgtacttctttacagtagattttcagatttcgacattggtctt
tttaaagctggtaagcattttagattatatgataagctggggtcgcatgtggtggagcat
gaaggaacaacaggtacctattttgcagtttgggcccctaatgctgatgcggtttcggtg
atcggtaattttaacggttggaacaacgaagcacattacctcggtgcacgatgggatgga
tcaggtatatgggaagggtttattccgaatatcggacaaggagaggcttacaaatatttt
atccgttctaactcaggagggtattttgaaagagctgatccttacgcattatattgcgaa
gagcctccgcgtacagcttctatcgtttggaatacttggtatgaatggcaagatcaggag
tggatgaaccgacgacctcaattcaatgcacttgataaacccatttctgtatatgaagtt
catttagcctcatggcgacgggatccgtcaaaccctgatcgttttctttcctatcgtgag
ctggcccgtgacttggttgagtatgtaactcacatgggatttacacatgtggagttcatg
cctgttatggaacatccatttttgggatcttggggttaccaggtgacagggtattttgca
ccaacatcacgctttggatctcctcaggatttcatgtttttaattgaaagtcttcataga
gcaggaattggtgtttacctcgattgggttccatctcattttcctggagatgctcatgga
ttgtataattatgacggttcacatttgtatgaacatgccgaccctcgtcagggctttcac
cccgactggagtagctatattttcaattatggaaggaatgaggttcgttcctttttgatc
agtaatgctttgttttggttcgatcgataccatgctgatgggttacgggttgatgctgtg
gcatctatgctatacctggattattcaaggaaagaaggagagtgggtaccgaatcaatat
ggagggcgagagaatttagatgctgtttctttcctgaaagaattaaatgaagtagcctat
gggaattatggcgatatacagatgattgccgaggaatccacttcttggcctggcgtttct
cacccaacctggcaaggaggattaggtttcggaatgaaatggatgatggggtggatgaat
gatacgcttcgctattttgctaaggaacctatttatcgtaggtatcatcaacaagaactt
acgttcagtactgtttatgcatttactgagaattttatgcttccgctttcacatgacgaa
gtggtgcatggaaaaggtgcattagttagtaaaatgcctggcgatgagtggcaacgcttt
gctaaccttcgcttattgtacgcttttatgtatacccacccgggaaccaaattgttattc
atgggtggcgaattcggacaaacttcggaatggagtcatgattattcgctcgactggcac
ttaactcaatacgagccacacaaaggagttgaaaacatgatgtgtgatttaaatcgtttg
tataagaatgaaccagctttgtacgattttaactttgccggatatggttttgaatggatc
gatcaatctgatagtgaaaattgtgtattggtttattgtcggaaaggacaccattggcag
gagtatgtagtagttgttgctaatctaacaccagtcgctcgtcatgattatcgtatcggg
ttaccgcacaatggcacctggtccgaaatatttaactcagacaagcacgattattgggga
agtggtgtggtaaatcattatcctaaagaagcagaaatggaaagctggcaaggtaaggca
caatcaatttcaattagtttgccgccatcgggtattaccgtttggaaattaaaagaacat
ccggatgtgagtaatagtaattattcggagaataatataaaggaggagaagaagaaaaaa
gcgcctaaaggcttatccgacggtaaataa

DBGET integrated database retrieval system