KEGG   Solitalea canadensis: Solca_0452Help
Entry
Solca_0452        CDS       T02084                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scn  Solitalea canadensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Solca_0452
Enzymes [BR:scn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Solca_0452
Exosome [BR:scn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Solca_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559839..561848
Genome map
AA seq 669 aa AA seqDB search
MHYSPSVLLYSRFSDFDIGLFKAGKHFRLYDKLGSHVVEHEGTTGTYFAVWAPNADAVSV
IGNFNGWNNEAHYLGARWDGSGIWEGFIPNIGQGEAYKYFIRSNSGGYFERADPYALYCE
EPPRTASIVWNTWYEWQDQEWMNRRPQFNALDKPISVYEVHLASWRRDPSNPDRFLSYRE
LARDLVEYVTHMGFTHVEFMPVMEHPFLGSWGYQVTGYFAPTSRFGSPQDFMFLIESLHR
AGIGVYLDWVPSHFPGDAHGLYNYDGSHLYEHADPRQGFHPDWSSYIFNYGRNEVRSFLI
SNALFWFDRYHADGLRVDAVASMLYLDYSRKEGEWVPNQYGGRENLDAVSFLKELNEVAY
GNYGDIQMIAEESTSWPGVSHPTWQGGLGFGMKWMMGWMNDTLRYFAKEPIYRRYHQQEL
TFSTVYAFTENFMLPLSHDEVVHGKGALVSKMPGDEWQRFANLRLLYAFMYTHPGTKLLF
MGGEFGQTSEWSHDYSLDWHLTQYEPHKGVENMMCDLNRLYKNEPALYDFNFAGYGFEWI
DQSDSENCVLVYCRKGHHWQEYVVVVANLTPVARHDYRIGLPHNGTWSEIFNSDKHDYWG
SGVVNHYPKEAEMESWQGKAQSISISLPPSGITVWKLKEHPDVSNSNYSENNIKEEKKKK
APKGLSDGK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcattattctccttccgtacttctttacagtagattttcagatttcgacattggtctt
tttaaagctggtaagcattttagattatatgataagctggggtcgcatgtggtggagcat
gaaggaacaacaggtacctattttgcagtttgggcccctaatgctgatgcggtttcggtg
atcggtaattttaacggttggaacaacgaagcacattacctcggtgcacgatgggatgga
tcaggtatatgggaagggtttattccgaatatcggacaaggagaggcttacaaatatttt
atccgttctaactcaggagggtattttgaaagagctgatccttacgcattatattgcgaa
gagcctccgcgtacagcttctatcgtttggaatacttggtatgaatggcaagatcaggag
tggatgaaccgacgacctcaattcaatgcacttgataaacccatttctgtatatgaagtt
catttagcctcatggcgacgggatccgtcaaaccctgatcgttttctttcctatcgtgag
ctggcccgtgacttggttgagtatgtaactcacatgggatttacacatgtggagttcatg
cctgttatggaacatccatttttgggatcttggggttaccaggtgacagggtattttgca
ccaacatcacgctttggatctcctcaggatttcatgtttttaattgaaagtcttcataga
gcaggaattggtgtttacctcgattgggttccatctcattttcctggagatgctcatgga
ttgtataattatgacggttcacatttgtatgaacatgccgaccctcgtcagggctttcac
cccgactggagtagctatattttcaattatggaaggaatgaggttcgttcctttttgatc
agtaatgctttgttttggttcgatcgataccatgctgatgggttacgggttgatgctgtg
gcatctatgctatacctggattattcaaggaaagaaggagagtgggtaccgaatcaatat
ggagggcgagagaatttagatgctgtttctttcctgaaagaattaaatgaagtagcctat
gggaattatggcgatatacagatgattgccgaggaatccacttcttggcctggcgtttct
cacccaacctggcaaggaggattaggtttcggaatgaaatggatgatggggtggatgaat
gatacgcttcgctattttgctaaggaacctatttatcgtaggtatcatcaacaagaactt
acgttcagtactgtttatgcatttactgagaattttatgcttccgctttcacatgacgaa
gtggtgcatggaaaaggtgcattagttagtaaaatgcctggcgatgagtggcaacgcttt
gctaaccttcgcttattgtacgcttttatgtatacccacccgggaaccaaattgttattc
atgggtggcgaattcggacaaacttcggaatggagtcatgattattcgctcgactggcac
ttaactcaatacgagccacacaaaggagttgaaaacatgatgtgtgatttaaatcgtttg
tataagaatgaaccagctttgtacgattttaactttgccggatatggttttgaatggatc
gatcaatctgatagtgaaaattgtgtattggtttattgtcggaaaggacaccattggcag
gagtatgtagtagttgttgctaatctaacaccagtcgctcgtcatgattatcgtatcggg
ttaccgcacaatggcacctggtccgaaatatttaactcagacaagcacgattattgggga
agtggtgtggtaaatcattatcctaaagaagcagaaatggaaagctggcaaggtaaggca
caatcaatttcaattagtttgccgccatcgggtattaccgtttggaaattaaaagaacat
ccggatgtgagtaatagtaattattcggagaataatataaaggaggagaagaagaaaaaa
gcgcctaaaggcttatccgacggtaaataa

DBGET integrated database retrieval system