KEGG   Solitalea canadensis: Solca_1072Help
Entry
Solca_1072        CDS       T02084                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
scn  Solitalea canadensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Solca_1072
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Solca_1072
Enzymes [BR:scn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Solca_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274951..1276441
Genome map
AA seq 496 aa AA seqDB search
MTPELSLLTLILLHVMNKRVTLAAIFAVTCLTTQAQQKFNSNGKKVTVYTTAQQTDLRLS
ENGKLDFQTFPQPLETQVFVLLDPSKTFQTIEGIGGALTDASAETFAKLPAAVQKEFLTA
YYDKDKGIGYTLARTNINSCDFSSGSYTYVKDNDTELKTFDIAHDKQYKIPLIKQATVAA
GGTLKLYVSPWSPPAWMKDNNNMLQGGKLLPQYRQSWANYFAKFIKAYEALGIPVWGLTV
QNEPMAKQTWESCIYTAEDERDFIKGYLGPTLHKEGLASKKLIAWDHNRDLIYQRASTIL
NDKAAAKYVWGIGFHWYETWNGGVMQFDNVKKVNEAYPDKQLIFTEGCKELFDITKVDDW
TLGERYGYSIVNDFNSGTAAWTDWNVLLDETGGPNHVKNLCFAPIHADTKAGKLIYTNAY
YYLGHFSKFVRPGAKRIASSSNRDQLSTTAFINPDGKIAVIVLNRSNDQLAYNLAIEGKA
VATTSLPHSITTFVIE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgaactgtcgttgttaacactaattctactacacgttatgaataaaagagta
actcttgcggctatttttgcagtaacctgtcttacgacgcaggctcagcaaaaatttaac
tcaaatggtaaaaaagtaactgtctacaccactgctcagcaaacggatcttcgtctatca
gaaaacggtaagcttgattttcagacattccctcaaccgttggaaacacaagtttttgta
ttgttagatccttcaaagacttttcaaacaattgaaggaattggaggtgcattaacggat
gcttctgcggagacgtttgcaaagcttcctgctgctgttcaaaaagagttcctaaccgca
tattacgataaggataaaggaattggttataccttggcacgaaccaatattaatagctgt
gattttagtagtggaagttacacttacgtaaaagataatgatactgaattaaaaacattc
gatattgctcacgataaacaatataaaattcccctgatcaaacaagctactgtagcagca
ggaggtacattaaaattatatgtaagtccgtggagtccacctgcatggatgaaagataat
aacaatatgctgcaaggaggaaagctacttcctcaataccgacagtcatgggcaaactat
tttgcaaagttcatcaaggcttatgaagcactagggattcctgtttggggattaaccgtt
caaaacgaacctatggcaaaacagacatgggaatcatgcatttatacagcagaagatgaa
cgtgatttcatcaaaggatatttaggcccaactttgcataaagaaggattagcaagtaaa
aaattaattgcctgggatcataaccgcgaccttatttatcagcgagcaagtactatttta
aatgacaaagctgctgcaaaatatgtttggggaattgggtttcattggtatgaaacatgg
aacggtggggtaatgcagtttgataatgttaaaaaagtgaatgaggcctatcctgataaa
cagttaatttttacagaaggatgcaaagagctgttcgatattacgaaagtggacgactgg
acactgggtgaacgctatggctattcaatagttaacgactttaatagtggcaccgctgcg
tggacagactggaacgttcttttggatgaaaccggtggtcctaaccatgtaaagaacctt
tgttttgcaccaattcatgctgataccaaagcaggtaaacttatttatactaacgcatat
tactacttggggcatttttcaaaatttgttcgtccaggggcgaaacgcattgcgagttca
tccaatcgtgatcagctgtcgactacagctttcatcaatcctgatgggaaaatagccgta
attgttttaaatcgctcaaatgaccaattggcttacaatttagccatagagggtaaagca
gtggctacaaccagtttaccgcattcaataacaacatttgtaatcgaataa

DBGET integrated database retrieval system