KEGG   Solitalea canadensis: Solca_1085Help
Entry
Solca_1085        CDS       T02084                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
scn  Solitalea canadensis
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:scn00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Solca_1085
   03410 Base excision repair
    Solca_1085
   03420 Nucleotide excision repair
    Solca_1085
   03430 Mismatch repair
    Solca_1085
Enzymes [BR:scn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Solca_1085
    6.5.1.6  DNA ligase (ATP or NAD+)
     Solca_1085
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Solca_1085
DNA replication proteins [BR:scn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     Solca_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292674..1294269
Genome map
AA seq 531 aa AA seqDB search
MKLFTNLFLQLDRTNKTNEKVALLKAYFLIAPDKDKLWALALFTGRRPPRKVKTTQVQHW
AMQQAGIPEWLFRESYNSVGDLAETISLILPESASVATKTMSEWFDYLSKLNSASDEEKE
KLITDAWKQLGTFETFVFNKLLMGSFRIGVSQTLVIRAIAEAFEIEPAVVAHRIMGQWNA
FETSFEGLIHAENSADELSKPYPFYLAYAIESDIENLGAVEEWFAEWKWDGIRSQLIYRN
NELYIWSRGEDLMTDKFPELHVLKDYLPANVVIDGELVCFANDKPLPFNLLQTRIGRKNL
TKKILTEAPVVILAYDLLEYEGNDIRDKPHAERRALLETVVQQVNMPYLLRLSPLVNFNE
WNELKLLHLQSRELAAEGFMLKRRSATYQVGRKKGDWWKWKVDPLSVDAVLVYAQKGHGR
RAELYTDYTFAVWDEEGKLIPFAKAYSGLTDEEIKIVDRFIRQNTLEKFGPVRTVTPELV
FEIGFEGINASSRHKSGIAVRFPRILNWRKDKPVEEADTLENLRNMLYQFK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttaccaacctgtttcttcagcttgatcgtaccaataaaacgaatgaaaaa
gtagccttgcttaaggcttatttcctgatagcccctgataaagataaattatgggcattg
gcactatttactggtcgtcgtccgccgcgaaaagttaaaactacgcaggttcagcactgg
gccatgcaacaggcaggtattcctgagtggctatttcgtgaaagttataatagtgttggt
gatttggctgaaaccatttcattgattttacccgaatcagcatctgttgcaactaaaacc
atgagcgaatggtttgattatctgtcgaaattaaactcagcatcagacgaagaaaaggaa
aaattgattacagatgcatggaaacaacttggaacttttgaaacctttgttttcaataaa
ttgctgatgggtagttttcggattggcgtttcacaaactttggttattagggctatagcc
gaagcttttgaaatagagcctgccgttgttgctcatcgcattatgggacaatggaatgct
tttgaaacttcatttgaagggcttattcatgctgaaaatagtgcagatgaattatccaag
ccgtatcctttctatttggcttatgctatcgaaagtgatattgaaaatttgggtgctgtc
gaagaatggtttgccgaatggaaatgggatggtattcgctcgcaattaatctaccgaaat
aatgaattgtacatctggtcgagaggggaagatctgatgaccgacaagtttcctgagttg
catgtgttaaaggattatcttccggcaaacgtagttattgatggcgaattggtttgtttt
gctaatgacaaaccactgccctttaatctgcttcaaacacgaattgggcgtaaaaaccta
acaaagaaaatactgacggaggctcctgttgtaatattggcttatgaccttttggagtac
gaggggaatgatattcgggataaacctcatgcagaacgtcgtgcattacttgaaactgta
gttcagcaagtaaacatgccttatttattacgattatcgcctttagttaatttcaatgaa
tggaatgagctaaagctgttgcacctacaatcgcgggaattggctgcggaaggctttatg
ttaaaaagaaggagtgcaacttatcaggttggtcgtaaaaaaggcgactggtggaagtgg
aaagttgatccattaagtgttgacgcagtattggtgtatgcccaaaaagggcatggaaga
agggccgagctatatacagattatacatttgctgtttgggatgaagaagggaaattaatt
ccatttgcaaaagcttattccggattaacggatgaagaaataaaaatagtcgatcgtttt
atcaggcaaaatacacttgagaaatttggtcctgttagaaccgtaacacctgaattggtt
tttgaaattggttttgagggtataaatgcttcgagccgacataaatcaggtattgctgta
cgatttccccgtatcttaaactggagaaaagataaacctgttgaagaagcggatacatta
gaaaaccttcgaaatatgctatatcaatttaaataa

DBGET integrated database retrieval system