KEGG   Solitalea canadensis: Solca_1085Help
Entry
Solca_1085        CDS       T02084                                 

Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
scn  Solitalea canadensis
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:scn03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:scn03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:scn03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:scn03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292674..1294269
Genome map
AA seq 531 aa AA seqDB search
MKLFTNLFLQLDRTNKTNEKVALLKAYFLIAPDKDKLWALALFTGRRPPRKVKTTQVQHW
AMQQAGIPEWLFRESYNSVGDLAETISLILPESASVATKTMSEWFDYLSKLNSASDEEKE
KLITDAWKQLGTFETFVFNKLLMGSFRIGVSQTLVIRAIAEAFEIEPAVVAHRIMGQWNA
FETSFEGLIHAENSADELSKPYPFYLAYAIESDIENLGAVEEWFAEWKWDGIRSQLIYRN
NELYIWSRGEDLMTDKFPELHVLKDYLPANVVIDGELVCFANDKPLPFNLLQTRIGRKNL
TKKILTEAPVVILAYDLLEYEGNDIRDKPHAERRALLETVVQQVNMPYLLRLSPLVNFNE
WNELKLLHLQSRELAAEGFMLKRRSATYQVGRKKGDWWKWKVDPLSVDAVLVYAQKGHGR
RAELYTDYTFAVWDEEGKLIPFAKAYSGLTDEEIKIVDRFIRQNTLEKFGPVRTVTPELV
FEIGFEGINASSRHKSGIAVRFPRILNWRKDKPVEEADTLENLRNMLYQFK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttaccaacctgtttcttcagcttgatcgtaccaataaaacgaatgaaaaa
gtagccttgcttaaggcttatttcctgatagcccctgataaagataaattatgggcattg
gcactatttactggtcgtcgtccgccgcgaaaagttaaaactacgcaggttcagcactgg
gccatgcaacaggcaggtattcctgagtggctatttcgtgaaagttataatagtgttggt
gatttggctgaaaccatttcattgattttacccgaatcagcatctgttgcaactaaaacc
atgagcgaatggtttgattatctgtcgaaattaaactcagcatcagacgaagaaaaggaa
aaattgattacagatgcatggaaacaacttggaacttttgaaacctttgttttcaataaa
ttgctgatgggtagttttcggattggcgtttcacaaactttggttattagggctatagcc
gaagcttttgaaatagagcctgccgttgttgctcatcgcattatgggacaatggaatgct
tttgaaacttcatttgaagggcttattcatgctgaaaatagtgcagatgaattatccaag
ccgtatcctttctatttggcttatgctatcgaaagtgatattgaaaatttgggtgctgtc
gaagaatggtttgccgaatggaaatgggatggtattcgctcgcaattaatctaccgaaat
aatgaattgtacatctggtcgagaggggaagatctgatgaccgacaagtttcctgagttg
catgtgttaaaggattatcttccggcaaacgtagttattgatggcgaattggtttgtttt
gctaatgacaaaccactgccctttaatctgcttcaaacacgaattgggcgtaaaaaccta
acaaagaaaatactgacggaggctcctgttgtaatattggcttatgaccttttggagtac
gaggggaatgatattcgggataaacctcatgcagaacgtcgtgcattacttgaaactgta
gttcagcaagtaaacatgccttatttattacgattatcgcctttagttaatttcaatgaa
tggaatgagctaaagctgttgcacctacaatcgcgggaattggctgcggaaggctttatg
ttaaaaagaaggagtgcaacttatcaggttggtcgtaaaaaaggcgactggtggaagtgg
aaagttgatccattaagtgttgacgcagtattggtgtatgcccaaaaagggcatggaaga
agggccgagctatatacagattatacatttgctgtttgggatgaagaagggaaattaatt
ccatttgcaaaagcttattccggattaacggatgaagaaataaaaatagtcgatcgtttt
atcaggcaaaatacacttgagaaatttggtcctgttagaaccgtaacacctgaattggtt
tttgaaattggttttgagggtataaatgcttcgagccgacataaatcaggtattgctgta
cgatttccccgtatcttaaactggagaaaagataaacctgttgaagaagcggatacatta
gaaaaccttcgaaatatgctatatcaatttaaataa

DBGET integrated database retrieval system