KEGG   Solitalea canadensis: Solca_1153Help
Entry
Solca_1153        CDS       T02084                                 

Definition
glycosyltransferase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
scn  Solitalea canadensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Solca_1153
Enzymes [BR:scn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Solca_1153
Glycosyltransferases [BR:scn01003]
 Polysaccharide
  Storage polysaccharide
   Solca_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1372988..1374802)
Genome map
AA seq 604 aa AA seqDB search
MQLEKKLLVEIAWEVCNQVGGIYTVIRSKAPAMVDIWGDNYCLIGPMFPGKMPAEFEPTD
KYNDAFGRAVLKMQKLGFEVHYGYWLVSGKPKVILINFAPIYSRLHEVKYFLWENHKIDT
SSFDELVDQTIAFGETVKQLLEQLAQPGTTTKKIHAHFHEWMVGTPIAHIKKNALPIKTV
FTTHATQLGRYLATTTPRFYDILPGVNWEKEARRFNCLSKVLIERSAAQNADVFTTVSEI
TGSECEILIGRKPDVITPNGINIERFVALHEFQNLHVEYKQKINQFVMGHFFHNYSFDLE
NTLYFFTSGRFEYVNKGFDLTIDAIDRLNKKMKKSGIDVTVVLFIITKQEYHSINSKVLH
SRALMEEVRDTCTAIRKQVGDKLFLASAYNPDQKMPALNDFVDDYWKLRLRRTLLSWKND
ELPYIVTHDLVDNHNDQIVNHLRRVNMVNEKNDRVKIVYHPDFISPTNPLFGLEYHQFIR
GCHLGVFPSYYEPWGYTPLECIASGIPTVTSDLSGFGDYVLSNLPSEESHGIYIVRRRHN
DYTKAAESLANMLFSFVQLTRRERISQRNMVESSSENFDWKYLVKYYRDAYQLIIEDDSV
TEEI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagagaagaaacttttagtcgaaatcgcttgggaagtatgtaaccaggttggg
ggcatttatacggttattcgttctaaggctcctgcaatggttgatatatggggcgataat
tattgcctgatcgggcctatgttcccaggaaaaatgcctgcagagtttgaacctaccgac
aaatacaatgatgcttttggacgtgccgtactaaaaatgcaaaaacttggttttgaggtt
cattatggctattggctggtatccggcaaacctaaagttatcctgatcaattttgctcct
atctacagccgattacatgaggtcaaatatttcctttgggaaaatcacaaaatcgatact
tccagttttgatgaattagttgaccaaaccattgcgtttggagaaactgtaaaacaatta
ctggaacaactcgcccaacctggcactacaaccaaaaaaattcatgcacattttcatgaa
tggatggtaggcacaccgatagcgcatatcaaaaaaaatgcattaccgataaaaacggta
tttaccactcacgccacccaattaggaaggtatcttgctactacaacaccacgattctat
gatattttaccgggtgtaaactgggaaaaggaagctcgcagattcaattgcctatcaaaa
gtactaattgaacgaagtgcggctcaaaatgcagatgtatttactacggtaagtgaaatt
accggctctgaatgtgaaatactgattggaagaaaacccgatgtaattactccaaatgga
attaacatcgaacgttttgtggccttgcatgagtttcaaaatttacatgtggagtataag
caaaagatcaatcagtttgtaatgggacatttctttcataactattcttttgatcttgaa
aatacgctttacttttttacttccggaagatttgaatatgtgaacaaaggatttgaccta
acgatagatgcgattgaccggctgaataaaaaaatgaagaaatcaggtattgatgttacg
gttgttttattcataattaccaaacaagagtatcattccatcaactcaaaagtgttgcat
tcacgtgcgctgatggaagaagttagggatacctgtacagcgataagaaaacaggttggc
gataagctttttcttgcttctgcctataatcctgatcaaaaaatgccggctcttaatgat
tttgttgatgattactggaaattacgtttacgtagaacattgttgagctggaaaaatgac
gaactaccctatattgttacgcatgatttggtagataatcataatgatcagattgtaaat
catctgcgacgtgtaaacatggtgaacgaaaaaaatgatagggttaaaatcgtttatcac
ccagactttatctctcctaccaatcctttatttggcctggaatatcatcaatttatcaga
ggttgccatttaggtgtatttccaagctactatgaaccctggggatacacaccgctagaa
tgtatagccagtggcattcctactgttacaagtgatctttccggctttggcgattatgta
ttgagcaatttgcctagcgaggaatcacatggtatctatattgttcgccgtcggcataac
gattacaccaaagccgccgaatcattagctaatatgctttttagttttgtacagctaacc
cgacgagaacgcatctcacaacgaaatatggtagaaagttcatcggaaaatttcgactgg
aaatacctggttaaatactatagagatgcttatcaattaattatcgaagacgattcagtt
actgaagaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system