KEGG   Solitalea canadensis: Solca_1514Help
Entry
Solca_1514        CDS       T02084                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scn  Solitalea canadensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Solca_1514
  Lipid metabolism
   00561 Glycerolipid metabolism
    Solca_1514
   00600 Sphingolipid metabolism
    Solca_1514
Enzymes [BR:scn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Solca_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1825111..1826301
Genome map
AA seq 396 aa AA seqDB search
MKTIMRMFLALLLCFVLSQANGQKFENLAERPPMGWNSWNKFGCEINEKIIKEVADAMTS
NGMKAAGYEYIVIDDCWQIGRDSLGNILADPDRFPSGISSLVDYVHANGLKFGIYSDAGT
ATCQGRPGSRGYEFQDARTYAKWNVDYLKYDWCFHGKQNAEASYTLMRDAIYKAGRPMVL
SICEWGTNKPWEWGKNVGHLWRTTEDIINCFDCKNNWGGLGVLQIIDLHTEIGEYSGPGH
WNDPDMLEIGNGVLTPAEERLHLSMWAMFSAPLMAGNDIRNMSAETLKLLTNKEVLEIDQ
DKLGISATRWMKYGDLEIWFKPLSDNNYAFCFINRSNQPITINHDLKTTIKKFKVDGNYK
VRDVWKHKDVGTTKENVVGVLPAHDVIMLKLTQIFL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactattatgagaatgtttttggctttgttgttatgttttgtcttaagccaggca
aatggacaaaagtttgaaaacttagcagaacgaccaccaatgggctggaacagctggaat
aagtttggctgtgagatcaatgaaaaaattataaaagaagttgccgatgcgatgacaagc
aatggaatgaaagcagcaggatatgaatatatagtgattgatgattgctggcaaataggg
agggatagtttagggaatattttagctgatccagaccgtttcccttcaggaattagtagt
ttggttgattatgtacatgcaaatgggttaaaatttggtatttactcagatgccggaacc
gcaacttgtcaggggcgaccaggaagcaggggttatgaatttcaggatgcaagaacctat
gccaagtggaatgtggattatttaaaatacgattggtgttttcatggtaaacaaaatgca
gaagcatcttataccttaatgagagatgcaatttataaagcaggccgaccaatggtttta
agtatttgcgaatggggaactaataagccttgggagtggggtaaaaacgttggccatcta
tggagaacaactgaagatattattaattgctttgattgtaagaataattggggaggatta
ggtgtacttcagatcattgatcttcatactgaaattggcgagtattcgggtccgggtcat
tggaatgatcctgatatgctcgaaatcgggaacggtgtgttaacgccggctgaagaacga
ttgcatttgagtatgtgggctatgttttcggcaccgctaatggccggcaatgatattcga
aacatgtcggccgaaacacttaagcttttaaccaataaagaagtattggaaattgaccag
gataagcttggaatatctgctaccagatggatgaaatacggtgacttagaaatttggttt
aagcctttgagtgataataattacgctttttgctttatcaacagaagcaatcaacctatt
actattaatcatgatttaaaaacaacaatcaagaaatttaaggtggatggtaattacaaa
gtgagagatgtatggaaacacaaagacgtaggaaccactaaagagaatgttgttggagta
ctaccggcacacgatgtaatcatgttaaaacttacccaaatttttttatag

DBGET integrated database retrieval system