KEGG   Streptomyces coelicolor: SCO0046Help
Entry
SCO0046           CDS       T00085                                 

Gene name
SCJ4.27
Definition
(RefSeq) hydrolase
  KO
K01118  
FMN-dependent NADH-azoreductase [EC:1.7.-.-]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.-  Acting on other nitrogenous compounds as donors
    1.7.-.-  
     SCO0046 (SCJ4.27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
36816..37478
Genome map
AA seq 220 aa AA seqDB search
MATLLHIDSSVFPAEASASRSVTAAFRRTWEEQHPEGTVIYRDLAAVPVPHITADAWSAG
YADPSERSTRQSAAFAARLELIEELERADVILIGAPMYNYTVPSTLKAWLDSVLLLGRTA
GEAPSAQGTPTVVVASRGGSYAPGTPREDFEFVQNYLEAVLRSTLGLDLEFIVPELTMAP
RNPAMSELLPLFESSRERAHSEAVTKAKELTERLTADNGR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcttctgcacatcgactcgtccgtgttcccggccgaggcgtccgcgtccagg
tccgtcacggccgcgttccgccgaacctgggaggagcagcacccggagggcacagtgatt
taccgcgacctcgccgccgtcccggtcccgcacatcaccgcggacgcctggtccgccggt
tacgccgacccgtccgagcgcagcacgcgccagtccgccgcgttcgccgcgcgcctggag
ctcatcgaggagctggagcgggcggacgtcatcctgatcggggcgcccatgtacaactac
acggtcccatccaccctcaaggcgtggctggacagcgtgctcctgctcggccgcacggcc
ggcgaggcaccctccgcacagggcacccccaccgtggtggtcgccagccgcggcggctcc
tacgcgccgggcaccccgcgcgaagacttcgagttcgtgcagaactacctggaggccgtt
ctgcgcagcaccctggggctggacctggagttcatcgtcccggaactcaccatggccccg
cgcaatccggccatgtccgaactgctcccgctcttcgaaagttcgcgggagcgcgcccac
agtgaggcggtcaccaaggcgaaggagctcaccgaacgtctcaccgcggacaacggcagg
tga

DBGET integrated database retrieval system