KEGG   Streptomyces coelicolor: SCO0171Help
Entry
SCO0171           CDS       T00085                                 

Gene name
SCJ1.20
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sco  Streptomyces coelicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO0171 (SCJ1.20)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     SCO0171 (SCJ1.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
161237..162553
Genome map
AA seq 438 aa AA seqDB search
MSDVTTTDLYEVTMALSYLLEDMSRPATFSLFVRDLPSERGFLVSAGIEPALDYLSAFRV
TPSDVEDFASALHRPYADLSPLCGMTFTGEVRAVPEGRVVFAGEPLLEVTAPLAEAQLVE
TFLLNQVSHQTAVASKAVRSVLAAAGRPVVDFSLRRTHGTSAGMQAARTAALTGFAGTSN
VAAAVRWGLPASGTMAHSYVEAFPDEEAAFRAFARAHPGPVTFLVDTYDSVRGVRTAARV
LRDLGRGPGCAVRLDSGDLGDLARRARAELDRSGLPGVRVVASGGLDEYGVDTLVRSGAP
IDVYAVGTRVGTSADAPYLDSAYKLVEYDGRPVMKLSSAKVTSPGRKQVFRRPGGDDVIA
LRDEPGPAGAEPLLRTVMRDGRRLGPPDTLPQGHARLTADLAGLPADAVRVRAPRPARAV
FSERLSELTADLSDRLRS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgtgaccactacggacttgtacgaagtcacgatggccctgtcctaccttctc
gaagacatgagccggcccgcgacgttcagtctgttcgtgcgtgacctgccttccgaacgt
ggattcctcgtcagcgcgggcatcgaaccggcgctcgactacctcagcgcctttcgcgtc
accccgtcggacgtggaggacttcgcctccgcgctgcaccggccgtacgccgacctctcc
ccgctgtgtggcatgacgttcaccggcgaggtgcgcgccgtgcccgagggacgtgtggtg
ttcgccggggaacccctgctggaggtcacggcgccgctcgcggaggctcagctcgtggag
acgttcctgctcaaccaggtgtcgcatcagacggccgtggcgtcgaaagcggtgcggtcc
gtcctggccgccgcgggacggccggtggtcgacttctcgctgcgccgcacgcacgggacc
tccgccgggatgcaggccgcgcgcacggcggcgctcacggggttcgcgggaaccagcaac
gtggcggcggcggtccgctggggcctgcccgcgtccgggacgatggcgcactcgtacgtc
gaggcgtttccggacgaggaggccgccttccgcgccttcgcccgcgcccatccggggccc
gtgacgttcctggtggacacgtacgactcggtacgcggggtccgtaccgcggctcgtgtc
ctgcgcgatctgggtcgggggccggggtgcgccgttcggctggacagcggtgacctcggt
gatctcgcccgtcgggcgcgcgccgaactggatcgctccggtcttcccggcgtccgtgtc
gtcgccagcggcggtctggacgagtacggcgtggacactctggtccgttccggggctccc
atcgacgtgtacgcggtcggcacccgtgtcggcacgtccgccgacgctccgtatctggac
tcggcgtacaagctcgtggagtacgacggccgcccggtcatgaaactgtcgtccgccaag
gtcacgtcgccagggcgcaaacaggttttccgccgaccgggtggtgacgacgtcatcgcc
ctgcgggacgagccgggtcctgccggggcggagccactgctgcgcacggtcatgcgtgac
ggccggcgtctcggcccgccggacaccctgccgcagggacacgcgcggctgacggcggac
ctggcggggctgcccgccgacgctgtgcgtgtccgggctccacggccggcccgagccgtg
ttctcggaacggctgtccgagctgaccgcggacctcagcgaccgcctccgctcgtga

DBGET integrated database retrieval system