KEGG   Streptomyces coelicolor: SCO0208Help
Entry
SCO0208           CDS       T00085                                 

Gene name
SCJ12.20
Definition
(RefSeq) pyruvate phosphate dikinase
  KO
K01006  
pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO0208 (SCJ12.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     SCO0208 (SCJ12.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
197221..199917
Genome map
AA seq 898 aa AA seqDB search
MARYVYDFTEGGRDMAGLLGGKGSNLAEMTRLGLPVPPGFTLTTEACRSVLDTGGEPPGL
WEEVAGHLTDLETGSGRLLGQPDNPLLLSVRSGARFSMPGMMETILDIGLDDDSVHGLAK
VSGNERFAWDSYRRLVQMFGTTVMGVDPSLFERALAQLKEVRGVPDDVHLDAEDLARLVE
TYKNVIHQETGERFPQSPVEQLRRAVLAVFASWNGERARLYRRREHIADDLGTAVNVQRM
VFGNLGSDSGSGVAFTRDPATGARGLYGDYLPNAQGEDVVAGIRNTVPLTELKRLDPGAY
GRLRAHMETLERHYRDLCDIEFTIERGTLWMLQTRVGKRTAEAAFVLGADLADEGLITAD
EGLARVSGEGLARLMFPRFDTAVTGDVLARGVPASPGAAVGAAVFDSAEAVRRAADGERV
VLVRQETTPDDLPGMIAAQAVLTSRGGKTSHAAVVARGMGKVCVCGADELTVDTGARRCT
APDGTIVEEGTVLSVDGTAGTVYAGAVPLVDSAVMRYLEAGAGGRATTGVVDAVARALAR
ADAVRRLEVRANADTPQDAVRARRFGAQGIGLCRTEHMFLGERRKLVEEMILAGTDAGRE
RALAALLPLQREDFTGILEAMDGLPVTIRLLDPPLHEFLPDRADLAVRIATAEARGEEPD
AHDAELLAAVGRMHEENPMLGLRGVRLGLVVPGLVAMQVRALGEAVAQRLTAGGAPRAEI
MVPLVGDVRELRLVREEVERVLAEVSDTSGVPVTCPVGTMIELPRAALTAGRIAEDAEFF
SFGTNDLTQTTWGFSRDDVEAEFFSAYLDRGVFPVSPFETLDRDGVGRLVGIAVEEGRAT
RPDLTIGVCGEHGGDPDSVHFFHSAGLDYVSCSPFRVPVARLEAGRAALDLADAGDSR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcccgttacgtgtacgacttcaccgagggcggccgtgacatggccggacttctcggt
ggcaagggatcgaatctggccgagatgacccggctcgggctgccggtgccgccggggttc
accctcaccaccgaggcgtgccggagcgtcctggacaccggtggtgagcctcccggcctg
tgggaggaggttgccgggcatctgacggacctggagaccggctcgggccggctgctcggg
cagccggacaaccccctgctgctgtccgtccgctccggcgcgaggttctccatgcccggc
atgatggagacgatcctcgacatcggtctcgacgacgactccgtccacgggctggccaag
gtctccgggaacgagcgcttcgcctgggactcctaccggcgtctcgtgcagatgttcggc
accaccgtcatgggcgtcgacccgtcactgttcgaacgggccctcgcccagctcaaggag
gtgcgcggcgtcccggacgacgtgcacctggacgccgaagacctggcccggctcgtggag
acgtacaagaacgtcatccaccaggagaccggcgagcgcttcccgcagtcacccgtcgag
cagttgcgccgggcggtcctggccgtcttcgcgtcctggaacggtgaacgggctcgcctg
taccggcgccgcgagcacatcgccgacgacctgggcaccgccgtcaacgtgcagcgcatg
gtgttcggcaacctcggctccgactccggcagcggcgtcgccttcacccgcgacccggcc
accggggcccggggcctgtacggcgactacctgccgaacgcccagggcgaggacgtcgtc
gccgggatccgcaacaccgtgccgctgaccgaactgaagcgcctggaccccggcgcgtac
ggccggttgcgggcgcacatggagaccctggagcggcactaccgcgatctgtgcgacatc
gagttcaccatcgaacgcggcaccctgtggatgctccagacccgagtgggcaagcgcacc
gccgaggccgccttcgtcctcggcgccgatctggccgacgaagggctcatcaccgcggac
gagggcctcgcccgggtcagcggcgagggcctggcccggttgatgttcccgcgcttcgac
accgcggtgaccggtgacgtgctggcccgcggtgtcccggcctcgccgggtgccgcggtg
ggtgccgcggtcttcgactcggctgaggccgtccgccgcgccgccgacggggagagggtg
gtcctcgtccggcaggagaccacgcccgacgacctgcccggcatgatcgccgctcaggcc
gtgctcaccagtcgcggaggcaagacgagccatgccgccgtcgtggcgcgcggcatgggc
aaggtctgcgtctgcggtgccgacgaactcaccgtggacaccggggcccggcgctgcacc
gcaccggacgggacgatcgtcgaggagggcaccgtcctgtccgtggacggtaccgccggg
acggtgtacgcgggcgcggtgccgctggtcgactcggccgtcatgcgctacctggaggcc
ggggcgggcggccgggcgacgaccggtgtggtcgacgcggtggcccgggcgctggcccgc
gcggacgccgtccggcggctggaggtgcgggccaacgccgacacgcctcaggacgccgtt
cgcgcgcgccggttcggcgcacagggaatcggtctgtgccgcaccgagcacatgttcctc
ggcgagcggcgcaagctggtcgaggagatgatcctggcggggacggacgcggggcgcgag
cgggcgctcgcagccctgctgccgctccagcgcgaggacttcaccggcatcctggaggcg
atggacggcctgccggtcaccatacggctcctcgatccgccgctgcacgagttcctgccg
gaccgcgccgacctggcggtgcggatcgccaccgccgaggcccgcggcgaggaaccggac
gcgcacgacgccgagctgctggccgccgtcggccgcatgcacgaggagaacccgatgctc
gggctgcgcggggtgcgcctgggcctggtggtccccggcctggtcgccatgcaggtgcgg
gcgctcggtgaggccgtggcgcagcgcctcacggccgggggcgccccccgggcggagatc
atggtgccgctcgtcggggacgtgcgggaactgcggctcgtgagggaggaggtggagcgg
gtcctggccgaggtctccgacacctcgggagtgccggtcacgtgccccgtcggcaccatg
atcgagttgcccagggcggcgctcacggccggccggatcgccgaggacgccgagttcttc
tccttcggaaccaacgacctgacccagaccacctgggggttctcccgcgacgacgtcgag
gccgagttcttctccgcctacctcgacaggggcgtcttccccgtctcgcccttcgagaca
ctcgaccgcgacggcgtgggccggctggtcggcatcgccgtcgaagagggccgcgccacc
cggccggacctcacgatcggcgtctgcggcgagcacggcggtgacccggactcggtgcac
ttcttccactccgccggcctcgactacgtctcctgctccccgttccgggtcccggtggcc
cggctggaggccgggcgggccgcgctggacctcgccgatgccggcgacagccgatga

DBGET integrated database retrieval system