KEGG   Streptomyces coelicolor: SCO0216Help
Entry
SCO0216           CDS       T00085                                 

Gene name
narG2
Definition
(RefSeq) nitrate reductase subunit alpha NarG2
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Organism
sco  Streptomyces coelicolor
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO0216 (narG2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO0216 (narG2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     SCO0216 (narG2)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     SCO0216 (narG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
206480..210181
Genome map
AA seq 1233 aa AA seqDB search
MENDQNARRGRPGVARDWPLAARRLLTRREVSADGRAVFGTGDDKWEGFYRDRWAHDKVV
RSTHGVNCTGSCSWMVYVKDGIITWEHQATDYPSIGTDCPEYEPRGCPRGASFSWYTYSP
SRVRYPYVRGALLKLWREARRRLGDPVAAWAEITSDPAKARAYKKARGRGGLVRAGWDEV
SELIAAAQVHTVKAYGPDRVAGFSPIPAMSMASFAAGARYHSLIGGTLLSFYDWYADLPV
ASPQVFGDQTDVPEAADWWNAGYLIMWGSNIPVTRTPDAHFLTETRYNGTKAVAVSPDYA
DNVKHADEWLAPHPGTDGALAMAMGHVILREFLVEREVPYFQQYLRTFTDAPFLVSLREH
ADGGLVPDGFLTAADLGHEVENAGSKTVLLDSATGEPVVPGGSVGFRWAKEEQSRWNLDL
GDVVPELSLLERAEDTVPIALPRFDEGATEGGGSMVRGVPVRRLGGRLVTTVFDLMLAQY
GVGRPGLPGDWPSSYDDADRPHTPAWQETITSVPAEQAARIAREFARNAERTGGRSMIAL
GAGTNHWFHSDTIYRAFLALTTMTGCQGVNGGGWAHYVGQEKVRPLTGQQHLSFAFDWQR
PTRHMAGTSYWYLNSDQWRYEAFGPDELASPLGEGRFKGKAFADCLAQAVRLGWTPGHPG
FNRNPLDLTDEARAAGRPVAEHIVDELKSGRLRFAAEDPDDPANFPRVLTVWRANLLGSS
GKGNEYFLRHLLGTDAAVRSEETPPEGRPKDVVWREEAPEGKLDLLVTMDFRMTSTGLLS
DVVLPAATWYEKDDLSSTDMHPFVHAFTPAIAPPWQARTDYDSFLTLADRFSELAAEHLG
TRTDVLPVPLLHDTPDELAQPGGVVRDWKAGECEPVPGRTMPKLAVVERDYAAIAQKMRA
VGPLLDTLGTTTKGVTVHPDREIDDLRHRNGTVRDGLAAGRPSLATASDMCEAILALSGT
TNGRLATEGFRELERQTGSEGLVELSAEREAERITFADTRTQPRSVITSYEWSGSETGGR
RYSPFVINTEHKKPWHTLTGRQHFFVQHDWMTELGEQLPVYRPPLNSPRHYGDERLHEDG
RAEVTVRYLTPHSKWSIHSNYQDNKYMLDLSRGGPTIWMSLQDAEKIGVKDNEWIEAYNR
NGVVACRAVVTHRMPEGTVYMHHAQDRTVNVPKTEVGGKRGGIHNSLTRLLLKPTHLAGG
YAQFTYAFNYYGPTGNQRDEVTVIRRRDQRVEY
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgatcagaacgcacgccgaggccggccgggcgtcgcccgggactggcctctc
gcggcccggcggctgctgacgcgccgtgaggtgtcggccgacggacgtgccgtcttcggc
acgggtgacgacaagtgggaggggttctaccgtgaccggtgggcgcacgacaaggtggtg
cgctccacgcacggggtcaactgcacggggtcgtgctcctggatggtgtacgtcaaggac
ggcatcatcacctgggagcaccaggcgaccgactacccctcgatcggcacggactgcccc
gagtacgagccgcgcggctgcccgcgcggggcgtcgttctcctggtacacgtactcgccc
agccgggtccgctacccgtacgtacggggcgcgctgctgaagctgtggcgcgaggcccgc
cggcggctcggcgaccccgtggcggcctgggcggagatcacctccgacccggcgaaggcc
cgcgcgtacaagaaggcccggggccggggcggcctggtgcgcgccggctgggacgaggtg
agcgagctgatcgccgccgcgcaggtgcacaccgtcaaggcgtacggtcccgaccgcgtc
gccggcttctcgcccatcccggcgatgtcgatggcgtccttcgcggccggtgcccgctac
cactcgctgatcgggggcaccctgctgtcgttctacgactggtacgccgaccttccggtc
gcgtcgccgcaggtcttcggcgaccagacggacgttccggaggccgccgactggtggaac
gccggctacctgatcatgtggggctccaacatccccgtcacccgcacgcccgacgcgcac
ttcctcaccgagacccgctacaacggcaccaaggcggtcgccgtcagccccgactacgcc
gacaacgtgaagcacgccgacgagtggctcgccccgcacccgggcacggacggcgccctg
gcgatggccatggggcacgtgatcctgcgggagttcctcgtcgagcgcgaggtgccctac
ttccagcagtacctgcgcacgttcacggacgcgccgttcctggtctccctgcgcgagcac
gcggacggcggtctggtcccggacgggttcctgaccgccgccgacctcggccacgaggtg
gagaacgccggctccaagaccgtcctgctggactcggcgacgggcgagcccgtggtcccg
ggcggctcagtggggttccgctgggccaaggaggagcagagccgctggaacctcgacctg
ggcgacgtggtgcccgaactgagcctgctggagcgggccgaggacacggtgccgatcgcc
ctgcctcgtttcgacgaaggtgccaccgagggcgggggcagcatggtccgcggggtcccg
gtgcgccggctcggcggacggctcgtcacgaccgtcttcgacctgatgctcgcccagtac
ggggtcgggcgccccggtctgccgggcgactggccgtcctcgtacgacgacgcggaccgg
ccccacaccccggcctggcaggagacgatcacttccgtcccggcggagcaggcggcccgg
atcgcccgcgagttcgcccgcaacgccgagcgtacgggtggccgttcgatgatcgccctc
ggggcgggcaccaaccactggttccattcggacaccatctaccgggccttcctggcgctg
acgaccatgaccggctgccagggcgtcaacggcggcgggtgggcgcactacgtcggccag
gagaaggtgcgcccgctgaccggacagcagcatctgtcgttcgcgttcgactggcagcgg
cccacccggcacatggcgggcacatcgtactggtacctgaattccgaccagtggcgctac
gaggcgttcgggcccgacgagctggcctctccgctgggcgagggccggttcaaggggaag
gccttcgccgactgcctggcgcaggccgtgcggctgggctggacgccggggcacccgggc
ttcaaccgcaacccgctcgacctgacggacgaggcgagggccgcgggccggccggtcgcc
gagcacatcgtggacgaactgaagtcggggcggctgcggttcgccgccgaggaccccgac
gacccggccaacttcccgcgcgtgctgaccgtgtggcgggccaacctgctgggctcctcg
ggcaagggcaacgagtacttcctgcgccacctgctgggcaccgacgccgcggtgcgctcc
gaggagaccccgcccgaggggcgtccgaaggacgtggtgtggcgtgaggaggctcccgag
ggcaagctcgacctcctggtcaccatggacttccggatgacctccaccgggctgctctcc
gacgtggtcctgccggccgccacctggtacgagaaggacgacctgtccagcacggacatg
caccccttcgtgcacgccttcaccccggccatcgccccgccgtggcaggcccgcaccgac
tacgacagcttcctgaccctcgccgaccgcttcagcgagctggccgccgagcacctcggt
acccgcaccgacgtgctgccggtgccgctgctgcacgacacccccgacgaactggcccag
cccggcggggtggtgcgggactggaaggccggcgagtgcgaaccggtcccgggccgcacc
atgccgaagctggccgtcgtcgagcgggactacgccgcgatcgcgcagaagatgcgcgcc
gtcggtccgctgctggacaccctgggcaccaccaccaagggtgtcaccgtccacccggac
cgggagatcgacgacctccgccaccgcaacggcaccgtccgcgacgggctggccgccggg
cgtccctcgctcgccaccgcctccgacatgtgcgaggcgatcctcgccctgtccggcacc
accaacgggcggctggccaccgagggattccgcgagctggagcggcagaccggcagcgag
ggcctggtggaactgtccgccgagcgcgaggcggagcgcatcaccttcgccgacacccgc
acccagccgcgctccgtcatcacctcgtacgagtggtcgggctcggagaccggcggacgc
cgctactcccccttcgtcatcaacaccgagcacaagaagccctggcacaccctcaccgga
cgccagcacttcttcgtccagcacgactggatgacggaactcggtgagcaactccccgtc
taccgaccgccgttgaattcgccgcggcactacggcgacgagcggttgcacgaggacggg
cgggccgaggtcacggtgcgctacctcaccccgcactcgaagtggtccatccactccaac
taccaggacaacaagtacatgctcgacctgtcccggggcggccccaccatctggatgtcg
ctccaggacgccgagaagatcggcgtcaaggacaacgagtggatcgaggcgtacaaccgc
aacggtgtcgtcgcctgccgggccgtggtcacccaccgcatgcccgaggggacggtgtac
atgcaccatgcccaggaccgcaccgtgaacgtgccgaagaccgaggtcggtggcaagcgc
ggcggcatccacaactccctcacccggctgctgctcaagccgacccatctcgcgggcggc
tacgcccagttcacctacgccttcaactactacggtccgaccggcaaccagcgcgacgag
gtcaccgtcatccgccgccgcgaccagcgagtggagtactga

DBGET integrated database retrieval system