KEGG   Streptomyces coelicolor: SCO0216Help
Entry
SCO0216           CDS       T00085                                 

Gene name
narG2
Definition
(RefSeq) nitrate reductase subunit alpha NarG2
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.4]
Organism
sco  Streptomyces coelicolor
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO0216 (narG2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO0216 (narG2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     SCO0216 (narG2)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     SCO0216 (narG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
206480..210181
Genome map
AA seq 1233 aa AA seqDB search
MENDQNARRGRPGVARDWPLAARRLLTRREVSADGRAVFGTGDDKWEGFYRDRWAHDKVV
RSTHGVNCTGSCSWMVYVKDGIITWEHQATDYPSIGTDCPEYEPRGCPRGASFSWYTYSP
SRVRYPYVRGALLKLWREARRRLGDPVAAWAEITSDPAKARAYKKARGRGGLVRAGWDEV
SELIAAAQVHTVKAYGPDRVAGFSPIPAMSMASFAAGARYHSLIGGTLLSFYDWYADLPV
ASPQVFGDQTDVPEAADWWNAGYLIMWGSNIPVTRTPDAHFLTETRYNGTKAVAVSPDYA
DNVKHADEWLAPHPGTDGALAMAMGHVILREFLVEREVPYFQQYLRTFTDAPFLVSLREH
ADGGLVPDGFLTAADLGHEVENAGSKTVLLDSATGEPVVPGGSVGFRWAKEEQSRWNLDL
GDVVPELSLLERAEDTVPIALPRFDEGATEGGGSMVRGVPVRRLGGRLVTTVFDLMLAQY
GVGRPGLPGDWPSSYDDADRPHTPAWQETITSVPAEQAARIAREFARNAERTGGRSMIAL
GAGTNHWFHSDTIYRAFLALTTMTGCQGVNGGGWAHYVGQEKVRPLTGQQHLSFAFDWQR
PTRHMAGTSYWYLNSDQWRYEAFGPDELASPLGEGRFKGKAFADCLAQAVRLGWTPGHPG
FNRNPLDLTDEARAAGRPVAEHIVDELKSGRLRFAAEDPDDPANFPRVLTVWRANLLGSS
GKGNEYFLRHLLGTDAAVRSEETPPEGRPKDVVWREEAPEGKLDLLVTMDFRMTSTGLLS
DVVLPAATWYEKDDLSSTDMHPFVHAFTPAIAPPWQARTDYDSFLTLADRFSELAAEHLG
TRTDVLPVPLLHDTPDELAQPGGVVRDWKAGECEPVPGRTMPKLAVVERDYAAIAQKMRA
VGPLLDTLGTTTKGVTVHPDREIDDLRHRNGTVRDGLAAGRPSLATASDMCEAILALSGT
TNGRLATEGFRELERQTGSEGLVELSAEREAERITFADTRTQPRSVITSYEWSGSETGGR
RYSPFVINTEHKKPWHTLTGRQHFFVQHDWMTELGEQLPVYRPPLNSPRHYGDERLHEDG
RAEVTVRYLTPHSKWSIHSNYQDNKYMLDLSRGGPTIWMSLQDAEKIGVKDNEWIEAYNR
NGVVACRAVVTHRMPEGTVYMHHAQDRTVNVPKTEVGGKRGGIHNSLTRLLLKPTHLAGG
YAQFTYAFNYYGPTGNQRDEVTVIRRRDQRVEY
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgatcagaacgcacgccgaggccggccgggcgtcgcccgggactggcctctc
gcggcccggcggctgctgacgcgccgtgaggtgtcggccgacggacgtgccgtcttcggc
acgggtgacgacaagtgggaggggttctaccgtgaccggtgggcgcacgacaaggtggtg
cgctccacgcacggggtcaactgcacggggtcgtgctcctggatggtgtacgtcaaggac
ggcatcatcacctgggagcaccaggcgaccgactacccctcgatcggcacggactgcccc
gagtacgagccgcgcggctgcccgcgcggggcgtcgttctcctggtacacgtactcgccc
agccgggtccgctacccgtacgtacggggcgcgctgctgaagctgtggcgcgaggcccgc
cggcggctcggcgaccccgtggcggcctgggcggagatcacctccgacccggcgaaggcc
cgcgcgtacaagaaggcccggggccggggcggcctggtgcgcgccggctgggacgaggtg
agcgagctgatcgccgccgcgcaggtgcacaccgtcaaggcgtacggtcccgaccgcgtc
gccggcttctcgcccatcccggcgatgtcgatggcgtccttcgcggccggtgcccgctac
cactcgctgatcgggggcaccctgctgtcgttctacgactggtacgccgaccttccggtc
gcgtcgccgcaggtcttcggcgaccagacggacgttccggaggccgccgactggtggaac
gccggctacctgatcatgtggggctccaacatccccgtcacccgcacgcccgacgcgcac
ttcctcaccgagacccgctacaacggcaccaaggcggtcgccgtcagccccgactacgcc
gacaacgtgaagcacgccgacgagtggctcgccccgcacccgggcacggacggcgccctg
gcgatggccatggggcacgtgatcctgcgggagttcctcgtcgagcgcgaggtgccctac
ttccagcagtacctgcgcacgttcacggacgcgccgttcctggtctccctgcgcgagcac
gcggacggcggtctggtcccggacgggttcctgaccgccgccgacctcggccacgaggtg
gagaacgccggctccaagaccgtcctgctggactcggcgacgggcgagcccgtggtcccg
ggcggctcagtggggttccgctgggccaaggaggagcagagccgctggaacctcgacctg
ggcgacgtggtgcccgaactgagcctgctggagcgggccgaggacacggtgccgatcgcc
ctgcctcgtttcgacgaaggtgccaccgagggcgggggcagcatggtccgcggggtcccg
gtgcgccggctcggcggacggctcgtcacgaccgtcttcgacctgatgctcgcccagtac
ggggtcgggcgccccggtctgccgggcgactggccgtcctcgtacgacgacgcggaccgg
ccccacaccccggcctggcaggagacgatcacttccgtcccggcggagcaggcggcccgg
atcgcccgcgagttcgcccgcaacgccgagcgtacgggtggccgttcgatgatcgccctc
ggggcgggcaccaaccactggttccattcggacaccatctaccgggccttcctggcgctg
acgaccatgaccggctgccagggcgtcaacggcggcgggtgggcgcactacgtcggccag
gagaaggtgcgcccgctgaccggacagcagcatctgtcgttcgcgttcgactggcagcgg
cccacccggcacatggcgggcacatcgtactggtacctgaattccgaccagtggcgctac
gaggcgttcgggcccgacgagctggcctctccgctgggcgagggccggttcaaggggaag
gccttcgccgactgcctggcgcaggccgtgcggctgggctggacgccggggcacccgggc
ttcaaccgcaacccgctcgacctgacggacgaggcgagggccgcgggccggccggtcgcc
gagcacatcgtggacgaactgaagtcggggcggctgcggttcgccgccgaggaccccgac
gacccggccaacttcccgcgcgtgctgaccgtgtggcgggccaacctgctgggctcctcg
ggcaagggcaacgagtacttcctgcgccacctgctgggcaccgacgccgcggtgcgctcc
gaggagaccccgcccgaggggcgtccgaaggacgtggtgtggcgtgaggaggctcccgag
ggcaagctcgacctcctggtcaccatggacttccggatgacctccaccgggctgctctcc
gacgtggtcctgccggccgccacctggtacgagaaggacgacctgtccagcacggacatg
caccccttcgtgcacgccttcaccccggccatcgccccgccgtggcaggcccgcaccgac
tacgacagcttcctgaccctcgccgaccgcttcagcgagctggccgccgagcacctcggt
acccgcaccgacgtgctgccggtgccgctgctgcacgacacccccgacgaactggcccag
cccggcggggtggtgcgggactggaaggccggcgagtgcgaaccggtcccgggccgcacc
atgccgaagctggccgtcgtcgagcgggactacgccgcgatcgcgcagaagatgcgcgcc
gtcggtccgctgctggacaccctgggcaccaccaccaagggtgtcaccgtccacccggac
cgggagatcgacgacctccgccaccgcaacggcaccgtccgcgacgggctggccgccggg
cgtccctcgctcgccaccgcctccgacatgtgcgaggcgatcctcgccctgtccggcacc
accaacgggcggctggccaccgagggattccgcgagctggagcggcagaccggcagcgag
ggcctggtggaactgtccgccgagcgcgaggcggagcgcatcaccttcgccgacacccgc
acccagccgcgctccgtcatcacctcgtacgagtggtcgggctcggagaccggcggacgc
cgctactcccccttcgtcatcaacaccgagcacaagaagccctggcacaccctcaccgga
cgccagcacttcttcgtccagcacgactggatgacggaactcggtgagcaactccccgtc
taccgaccgccgttgaattcgccgcggcactacggcgacgagcggttgcacgaggacggg
cgggccgaggtcacggtgcgctacctcaccccgcactcgaagtggtccatccactccaac
taccaggacaacaagtacatgctcgacctgtcccggggcggccccaccatctggatgtcg
ctccaggacgccgagaagatcggcgtcaaggacaacgagtggatcgaggcgtacaaccgc
aacggtgtcgtcgcctgccgggccgtggtcacccaccgcatgcccgaggggacggtgtac
atgcaccatgcccaggaccgcaccgtgaacgtgccgaagaccgaggtcggtggcaagcgc
ggcggcatccacaactccctcacccggctgctgctcaagccgacccatctcgcgggcggc
tacgcccagttcacctacgccttcaactactacggtccgaccggcaaccagcgcgacgag
gtcaccgtcatccgccgccgcgaccagcgagtggagtactga

DBGET integrated database retrieval system