KEGG   Streptomyces coelicolor: SCO0293Help
Entry
SCO0293           CDS       T00085                                 

Gene name
SC5G9.02
Definition
(RefSeq) beta-xylosidase
  KO
K17641  
beta-xylosidase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
285714..288104
Genome map
AA seq 796 aa AA seqDB search
MNADVTVDHTAEVSPWNDTTASVAARVDALIDAMTLREKTAQLYGVWVGASDEGGEVAPH
QHDMEEAVDLDALLPTGLGQLTRPFGTVPVDPALGALSLARTQARITATNRFGIPALAHD
ECLAGFAAWGATAYPVPLSWGATFDPDTVGRMASAIGRDMRAVGVHQGLAPVLDVVRDAR
WGRVEETIGEDPYLVGTIGTAYVRGLESAGIVATLKHFVGYSASRAGRNLAPSSMGPRER
ADILLPPFEMAIREGGARSVMNAYTDTDGVPSAADEELLTGLLRDTWSFDGTVVADYFAI
AFLKTLHGVAAEWADAAGLALRAGVDVELPGVKTYGAPLAEAVADGRVPETLVDRALRRT
LTQKARLGLLDPDWNPLPAALEGADLDDPAALRGRIDLDSPANRALARTVAEEAVVLLSN
DGTLPLARPRRIALLGPNADEAVAVLGCYSFPQHIGVRYPGTPHGIELPTLRVALAAEFP
DARITFARGTGVDDGDLTGLPEAVRVAREADIALVVLGDRAGLFGRGTSGEGCDVETLAL
PGAQQRLLDALLDLGTPLVTVLLAGRPYSLGRAVEESAAIVQSFFPGEEGTHAIAGVLSG
RVNPSGRLPVGVPRGPGSQPATYLGAKLAHAGEVSSIDPTPAFPFGHGLSYTRFDWTDLS
VDDQEAPTDGEFTLTFTVRNTGGRSGTEVVQLYLHDPVASVVQPVQRLVGYARVDLEPGE
ARRLRVTVPADLASFTGRDGRRVVEPGALELRLAASSADPRLTARVALTGVERHLDHTRR
LRSVVEQEPAARARAE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgacgtgaccgtagaccacaccgccgaagtctccccctggaacgacaccact
gcttccgtcgccgcgagagtcgacgccctgatcgacgcgatgaccctgcgggagaagacc
gcccagctgtacggagtctgggtgggcgcctccgacgagggcggtgaagtggcgccccac
cagcacgacatggaggaggccgtcgatctcgacgcgctcctgcccaccggactgggccag
ctgacccggcccttcggcaccgtcccggtcgaccccgccctgggtgcgctctccctggcc
cgcacccaggcccggatcaccgccacgaaccggttcggcatccccgctctcgcgcacgac
gagtgtctggccggcttcgccgcctggggtgcgacggcctaccccgtcccgctgtcctgg
ggtgccaccttcgaccccgacacggtggggcgcatggcctcggccatcgggcgggacatg
cgtgccgtcggcgttcaccaggggctcgcgcccgtcctggacgtggtccgcgacgcccgc
tggggccgggtcgaggagaccatcggcgaggacccgtacctcgtcggcaccatcggcacc
gcgtacgtgcggggtctcgagtcggccgggatcgtcgccaccctcaagcacttcgtcggg
tactcggcctctcgcgccggacgcaacctcgctccctcctccatgggcccgcgggagcgc
gccgacatcctgctgccccccttcgagatggcgatccgtgaaggcggcgcacggtcggtg
atgaacgcctacaccgacaccgacggcgtcccctccgcggccgacgaggaactgctcacc
gggctgctgcgcgacacgtggagcttcgacggcaccgtcgtcgccgactacttcgccatc
gccttcctgaagaccctgcacggtgtggcggccgagtgggccgacgccgccggtctggcg
ctgcgggcgggcgtcgacgtcgaactgcccggcgtcaagacatacggcgcgcccctggcg
gaggccgtcgccgacggccgtgtcccggagacgttggtcgaccgggcccttcgccggaca
ctcacccagaaggcgcggctcggcctgctcgatccggactggaaccccctgccggccgcg
ctcgaaggggcagacctcgacgatccggcggccctgcgcggccggatcgacctggacagt
ccggcgaaccgcgcactggcccgcacggtggccgaggaagccgtcgtgctgttgagcaac
gacggcacgctgccgctcgcgaggccgcgccgcatcgccctgctcggccccaacgccgac
gaggccgtcgccgtactgggctgctattcctttccccagcacatcggcgtccggtacccc
gggaccccgcacggcatcgagctgcccacgctgcgggtggcgctcgccgccgagttcccc
gacgctcggatcacgttcgcccgcggcaccggcgtcgacgacggggatctcaccggcctc
cccgaggccgtccgggtggcacgcgaggccgacatcgctctggtggtgctcggcgaccgc
gccgggctcttcgggcggggcaccagtggggaaggctgcgacgtcgagacgctggcactg
cccggggcacagcagcggttgctcgacgccctgctggacctggggacgcccttggtcacc
gtgctgctcgcgggacgaccgtactccctcggccgtgccgtcgaggagtccgcggcgatc
gtgcagtccttctttcccggtgaggaaggcacccacgcgatcgccggtgtgctcagcggc
cgcgtcaacccgtccgggcggctcccggtgggggtgccgcgcgggccggggtcccagccg
gccacctacctcggagcgaagctcgcccacgccggcgaggtgtccagcatcgacccgaca
ccggcgttccccttcggtcacggcctgtcctatacccggttcgactggacggacctgagc
gtggacgaccaggaggcaccgacggacggcgagttcaccctcaccttcaccgtccgcaac
accggcgggcggtccgggaccgaggtcgtccagctctatctgcacgacccggtcgcctcc
gtcgtccagccggtgcagcggctcgtcggctacgcccgggtcgacctggagcccggtgag
gcccggcggctgcgtgtcaccgtcccggccgatctcgcctcgttcaccggacgcgacgga
cggcgtgtggtcgaaccgggcgcgctggagctgaggctggccgcctccagcgcggaccca
cggctgaccgcgagggtcgcactgaccggagtcgaacggcacctggaccacacgcggcgc
ctgcgctccgtggtcgagcaggagccggctgcccgtgcccgagccgagtga

DBGET integrated database retrieval system