KEGG   Streptomyces coelicolor: SCO0364Help
Entry
SCO0364           CDS       T00085                                 

Gene name
SCF41.23
Definition
(RefSeq) enoyl-CoA hydratase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
369249..370055
Genome map
AA seq 268 aa AA seqDB search
MSDTGHLPPPDLGTDLVLLDVTDRVAILTLNRPAKLNAVTPGMSRALVRAIEWCDTTDEV
RALVVTGAGERSFSVGSDIGALDQYATPWDFRNRVDYCDAIRAARTPTVAAVGGYALGGG
LETALSCDIRLAADTASFGAPEITLGWIGGGGMTAFLSRAAGPGNAALMLLTGERIDAER
ALAWHLVSEVVPRAGLLDRARALAAVIASRAPVAAETAKINLRAAGNLPEDQALAYERDL
QTICFATEDAAEGRRAFAEKRSPVFHKR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacactggccacctcccgccgcccgacctcggcaccgacctcgtcctgctggac
gtcaccgaccgggtcgccatcctcaccctgaaccggcccgccaagctcaacgccgtcacc
cccggcatgtcccgggccctggtgcgggccatcgagtggtgcgacacgaccgacgaggtc
cgggcactcgtcgtcacgggggcgggcgaacgctccttcagcgtcggctcggacatcggc
gcactcgaccagtacgccaccccgtgggacttccgcaaccgcgtcgactactgcgacgcc
atccgcgccgcccgcaccccgaccgtcgccgcggtcgggggatacgccctgggcggaggg
ctggagaccgccctgtcctgcgacatccggctcgccgcggacaccgcgtccttcggcgca
ccggagatcacgctcggctggatcgggggcggcggcatgaccgccttcctcagccgcgcg
gccggcccgggcaacgcggcactgatgctgctcaccggcgaacgcatcgacgccgaacgg
gcgttggcctggcatctggtgagcgaggtcgtgccccgcgccggtctgctcgaccgggcc
cgcgccctcgccgccgtgatcgcctcccgcgccccggtggcggccgagacggcgaagatc
aacctgcgggccgccggaaacctgcccgaggaccaggcgctcgcctacgagcgcgacctg
cagaccatctgcttcgccaccgaggacgcggcggagggcaggcgcgcgttcgccgagaag
cgctcccccgtcttccacaagcgctga

DBGET integrated database retrieval system