KEGG   Streptomyces coelicolor: SCO0506Help
Entry
SCO0506           CDS       T00085                                 

Gene name
nadE
Definition
(RefSeq) NAD synthetase
  KO
K01916  
NAD+ synthase [EC:6.3.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO0506 (nadE)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.5  NAD+ synthase
     SCO0506 (nadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
542269..543099
Genome map
AA seq 276 aa AA seqDB search
MSEPASIALQKEIVRELEVAETFDAEREIERRVAFLAERLTSTGLRALVLGISGGVDSTT
AGRLCQLAVERARAAGHEALFYAMRLPHGVQADEDDAQQALSFIRPDRVLTVDIKPASDA
ALDALLAADVAFRDPHHQDFVHGNIKARQRMIAQYAVAGAHGGLVVGTDHAAEAVSGFFT
KFGDGAADVVPLTGLTKRRVRAVGDALGAPAALVRKVPTADLETLDPGKADEDALGVTYE
EIDDFLEGKPVTEQVFETIVTRYRQTDHKRRLPIAP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagccggcgtccatcgccctgcagaaggagatcgtccgggaactggaggtcgcc
gagaccttcgacgccgaacgggagatcgagcgccgggtggccttcctcgccgagcggctg
acctccacgggtctgcgtgcgctcgtgctcgggatcagcggcggggtcgactcgaccacc
gcgggcaggctgtgccagctggccgtggagcgggcccgcgccgcgggacacgaggcgctc
ttctacgcgatgcggctgccgcacggggtccaggccgacgaggacgacgcccagcaggca
ctctccttcatccggcccgaccgggtgctgacggtggacatcaagcccgcgagcgacgcg
gcgctcgacgccctgctcgccgccgacgtggccttccgggacccccaccaccaggacttc
gtgcacggcaacatcaaggcccggcagcgcatgatcgcgcagtacgcggtggccggggcg
cacggcggcctggtggtcggcaccgaccacgcggccgaggcggtctccggcttcttcacc
aagttcggcgacggcgccgccgacgtcgtaccgctgacgggcctcaccaagcgccgggtg
cgcgcggtcggggacgcgctgggcgcgcccgccgcgctggtccggaaggtcccgacggcc
gacctggagacactcgaccccggcaaggccgacgaggacgccctcggcgtcacctacgag
gagatcgacgacttcctggagggcaagccggtgacggagcaggtcttcgagacgatcgtc
acccgctaccggcagaccgaccacaagcggcggctgccgatcgctccttga

DBGET integrated database retrieval system