KEGG   Streptomyces coelicolor: SCO0524Help
Entry
SCO0524           CDS       T00085                                 

Gene name
SCF11.04
Definition
(RefSeq) gluconolactonase
  KO
K01053  
gluconolactonase [EC:3.1.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Ascorbate and aldarate metabolism
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0524 (SCF11.04)
   01220 Degradation of aromatic compounds
    SCO0524 (SCF11.04)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0524 (SCF11.04)
   00053 Ascorbate and aldarate metabolism
    SCO0524 (SCF11.04)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SCO0524 (SCF11.04)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     SCO0524 (SCF11.04)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO0524 (SCF11.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
555990..556898
Genome map
AA seq 302 aa AA seqDB search
MSTDGPYEILDDRFRTGRCANGDNRLEVLYDGCRWAEGPLYLPAWRQLVWSDIPNDRILR
WDEATGSVGVFRAPAGHSNGNTLDRQGRLVTCEQGNRRVTRTEPDGRVTVLAERFDGRRL
NSPNDSVVRSDGTIWFSDPDFGITSDYEGHRAESEIGACNVYRIDPVSGQVRLAADGFDG
PNGVILTPDERRLFVSDSRAARIHAFDIREDGTLSDGKVFAEGRGDVHFDNIRFDDEGRL
WAAALHDGVHCYDPDGTLIGRLRVPEPVSNVAFGGPKNNRLFITATTSLYSLVMSVTGAP
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacggcccgtacgagatcctggacgaccgcttccgcaccggacgctgtgcg
aacggagacaacaggctggaggtcctgtatgacggctgccgctgggccgagggcccgctg
tacctccccgcctggcgtcagctggtctggagcgacatccccaacgaccgcatcctgcgc
tgggacgaggccaccggctcggtcggcgtcttccgcgctcccgcgggccacagcaacggc
aacaccctcgaccggcagggccgcctggtcacctgcgagcagggcaaccggcgcgtcacc
cgtaccgaacccgacgggagggtgaccgtcctggccgagcgcttcgacggcaggcggctg
aacagtccgaacgactccgtcgtccgctccgacggcaccatctggttctccgacccggac
ttcggcatcaccagcgactacgagggtcatcgcgccgagtccgagatcggcgcgtgcaac
gtgtaccggatcgacccggtgtccgggcaggtgcggctcgccgccgacggtttcgacggg
cccaacggcgtgatccttacccccgacgagcggcggctgttcgtctccgactcgcgggcc
gcccggatccacgcgttcgacatccgggaggacggcacgctctccgacgggaaggtcttc
gccgagggccggggggacgtgcacttcgacaacatccgcttcgacgacgagggccgcctg
tgggccgccgccctgcacgacggtgtccactgctacgaccccgacggcacgctcatcggc
cgtctgcgcgtgcccgagcccgtctccaacgtcgccttcggcggccccaagaacaaccgc
ctgttcatcacggccaccacgtccctgtactccctggtgatgtcggtgacgggggcaccg
cgcctctga

DBGET integrated database retrieval system