KEGG   Streptomyces coelicolor: SCO0546Help
Entry
SCO0546           CDS       T00085                                 

Gene name
pyc, SCF11.26c
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0546 (pyc)
   01230 Biosynthesis of amino acids
    SCO0546 (pyc)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO0546 (pyc)
   00620 Pyruvate metabolism
    SCO0546 (pyc)
Enzymes [BR:sco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SCO0546 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(583523..586897)
Genome map
AA seq 1124 aa AA seqDB search
MFRKVLVANRGEIAIRAFRAGYELGARTVAVFPHEDRNSLHRLKADEAYEIGEQGHPVRA
YLSVEEIVRAARRAGADAVYPGYGFLSENPELARACEEAGITFVGPSARILELTGNKARA
VAAAREAGVPVLGSSAPSTDVDELVRAADDVGFPVFVKAVAGGGGRGMRRVEEPAQLREA
IEAASREAASAFGDSTVFLEKAVVEPRHIEVQILADGEGDVIHLFERDCSVQRRHQKVIE
LAPAPNLDPALRERICADAVNFARQIGYRNAGTVEFLVDRDGNHVFIEMNPRIQVEHTVT
EEVTDVDLVQSQLRIAAGQTLADLGLAQENITLRGAALQCRITTEDPANGFRPDTGQISA
YRSPGGSGIRLDGGTTHAGTEISAHFDSMLVKLSCRGRDFTTAVNRARRAVAEFRIRGVA
TNIPFLQAVLDDPDFQAGRVTTSFIEQRPHLLTARHSADRGTKLLTYLADVTVNKPHGER
PELVDPLTKLPTASAGEPPAGSRQLLAELGPEGFARRLRESSTIGVTDTTFRDAHQSLLA
TRVRTKDMLAVAPVVARTLPQLLSLECWGGATYDVALRFLAEDPWERLAALREAVPNLCL
QMLLRGRNTVGYTPYPTEVTDAFVQEAAATGIDIFRIFDALNDVEQMRPAIEAVRQTGSA
VAEVALCYTADLSDPSERLYTLDYYLRLAEQIVNAGAHVLAVKDMAGLLRAPAAATLVSA
LRREFDLPVHLHTHDTTGGQLATYLAAIQAGADAVDGAVASMAGTTSQPSLSAIVAATDH
TERPTGLDLQAVGDLEPYWESVRKVYAPFEAGLASPTGRVYHHEIPGGQLSNLRTQAVAL
GLGDRFEDIEAMYAAADRMLGRLVKVTPSSKVVGDLALHLVGAGVSPADFEQDPDRFDIP
DSVVGFLRGELGTPPGGWPEPFRSKALRGRAEARPLAELSEDDRDGLGKDRRATLNRLLF
PGPAREFDTHRASYGDTSILDSKDFFYGLRPGKEYTVDLDPGVRLLIELQAVGDADERGM
RTVMSSLNGQLRPIQVRDRSAATDVPVTEKADRANPGHVAAPFAGVVTLAVAEGDEVEAG
ATVATIEAMKMEASITAPKSGTVTRLAINRIQQVEGGDLLVQLA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaaggtgctggtcgccaaccgcggtgagatcgcgatccgtgcgtttcgggcg
ggctacgagctcggcgcgcgcaccgtcgccgtcttcccgcacgaggaccgcaattcgctg
caccggctcaaggccgacgaggcctacgagatcggggagcaggggcatcccgtccgcgcg
tacctctccgtggaggagatcgtgcgcgccgcccgccgtgcgggggccgacgccgtctac
ccgggctacggcttcctgtccgagaaccccgaactcgcccgcgcctgcgaggaggccggg
atcaccttcgtcggtcccagcgcccggatcctggaactgaccggcaacaaggcacgggcc
gtggccgccgcccgcgaggccggagtacccgtgctcggctcctcggcgccctccaccgac
gtggacgaactcgtacgcgccgccgacgacgtcggcttccccgtgttcgtcaaggcggtc
gcgggcggcggcgggcgcggcatgcgccgcgtcgaggaacccgcccagctgcgcgaggcc
atcgaggccgcctcccgcgaggccgcgtccgccttcggcgactccaccgtcttcctggag
aaggcggtcgtcgaaccccgccacatcgaggtgcagatcctcgccgacggcgagggcgac
gtcatccacctcttcgagcgggactgctcggtgcagcgccgccaccagaaggtgatcgag
ctggcgcccgcgcccaacctcgacccggccctgcgggagcggatctgcgccgacgccgtg
aacttcgcccggcagatcggctaccgcaacgcgggcaccgtcgagttcctcgtcgaccgg
gacggcaaccacgtcttcatcgagatgaacccgcgcatccaggtcgagcacacggtcacc
gaggaggtcaccgacgtcgacctggtccagtcccagctgcgcatcgccgccggccagacg
ctggccgacctcggactcgcccaggagaacatcaccctgcgcggtgccgcactccagtgc
cgcatcaccaccgaggacccggccaacggcttccgcccggacaccgggcagatcagcgcc
taccgttcgccgggcggctccggcatccggctcgacggcggtaccacccacgccggtacg
gagatcagcgcgcacttcgactcgatgctggtcaagctctcctgccggggacgggacttc
accaccgcggtgaaccgcgcccggcgtgcggtcgccgagttccgcatccgcggcgtcgcc
accaacatccccttcctccaggcggtcctggacgaccccgacttccaggccggccgggtc
accacctcgttcatcgaacagcgcccgcacctgctgaccgcccggcactccgccgaccgc
ggcaccaagctgctgacctacctcgccgacgtcacggtgaacaagccgcacggcgagcgc
cccgagctggtcgacccgctgaccaagctgccgacggcgtccgccggtgaaccgcccgcc
gggtcccgccagttgctggccgagctggggccggaggggttcgcccgccgactgcgcgag
tcgtccaccatcggcgtcaccgacaccaccttccgcgacgcccaccagtcgctgctcgcc
acccgggtgcgcaccaaggacatgctcgccgtggcgcccgtcgtcgcccgcaccctgccc
cagctgctgtccctggagtgctggggcggcgccacctacgacgtcgccctgcgcttcctc
gccgaggacccctgggagcggctagccgcgctgcgcgaggcggtgcccaacctctgcctc
cagatgctgctgcgcggccgcaacaccgtgggctacaccccgtacccgaccgaggtgacc
gacgccttcgtgcaggaggccgccgccaccggcatcgacatcttccgcatcttcgacgcc
ctcaacgacgtcgagcagatgcggcccgccatcgaggccgtacggcagaccggcagcgcc
gtcgccgaggtcgcgctctgctacaccgccgacctgtccgacccctccgagcggctctac
accctcgactactacctgcggctcgccgagcagatcgtgaacgccggagcgcacgtgctg
gccgtcaaggacatggccgggctgctgcgcgcaccggccgccgcgaccctggtgtccgcg
ctgcgccgggagttcgacctgccggtgcacctgcacacccacgacaccaccggcggccag
ctcgccacctacctggccgcgatccaggcgggcgcggacgccgtcgacggtgcggtggcg
tccatggcgggcaccacttcgcagccgtcgctgtcggcgatcgtggccgccaccgaccac
accgagcggcccaccggcctcgacctccaggccgtcggcgacctggagccgtactgggag
agcgtccgcaaggtctacgccccgttcgaggccggcctggcctccccgaccggccgggtc
taccaccacgagattcccggcggccagctctccaacctgcgcacccaggccgtcgcgctc
ggcctcggcgaccgcttcgaggacatcgaggccatgtacgccgccgccgaccggatgctg
ggccgcctggtgaaggtcaccccgtcctccaaggtggtcggcgacctggccctgcatctg
gtgggcgccggtgtctccccggcggacttcgagcaggaccccgaccggttcgacatcccg
gactccgtggtcggcttcctgcgcggcgagctgggcaccccgcccggcggctggcccgag
ccgttccgcagcaaggcgctgcgcggccgcgccgaggccaggccgctcgccgagctgtcc
gaggacgaccgcgacggcctcggcaaggaccgccgggcgacgctcaaccggctgctgttc
ccgggaccggcccgcgagttcgacacccaccgcgcctcgtacggcgacaccagcatcctc
gacagcaaggacttcttctacgggctgcgcccgggcaaggagtacacggtcgacctcgac
cccggcgtccggctgctcatcgaactccaggcggtcggcgacgccgacgagcgcggcatg
cgcaccgtgatgtcctccctgaacggacagctccgccccatccaggtccgcgaccggtcg
gccgccaccgacgtcccggtgacggagaaggccgaccgggcgaaccccggccacgtcgcg
gcgccgttcgccggtgtggtgaccctcgccgtcgccgagggcgacgaggtggaggccggg
gccaccgtggccaccatcgaggcgatgaagatggaggcgtcgatcacggccccgaagtcc
ggcacggtgaccaggctcgccatcaaccgcatccagcaggtcgagggcggcgatcttctc
gtccaactcgcctga

DBGET integrated database retrieval system