KEGG   Streptomyces coelicolor: SCO0548Help
Entry
SCO0548           CDS       T00085                                 

Gene name
fabB2, SCF11.28c
Definition
(RefSeq) 3-oxoacyl-ACP synthase
  KO
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCO0548 (fabB2)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO0548 (fabB2)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SCO0548 (fabB2)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     SCO0548 (fabB2)
Lipid biosynthesis proteins [BR:sco01004]
 Fatty acid synthase
  Component type
   SCO0548 (fabB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(587985..589271)
Genome map
AA seq 428 aa AA seqDB search
MSPRHAAGPAPGERAAVVTGLGLTTSLGGDVPSTWRALLDGGCGVERVDFGEPAGPAQVY
LAAPAAVDPGTVLSSAKAAHCDRSAQFALVAAREAVRDAGFPDPSALAGDGSRVAVVVGV
GLGGLTSVLEQDHRLRTQGAGRVSPRTIPVMLPNHAAAEVGLMVGAKAGVHAPVSACAAG
AEALAQALGMIRDGRADIVVAGGTEAALHPLVLAGFARLRALSRRHDDPKGASRPFDADR
DGFVMGEGAGMLVVESAAHAAARGARVHGRLTGAGITNDSHHVAQPAPGGPGCAAAVDAA
LRDAGLVPEQIQHVNAHATATPLGDLGEAQALHSVFAKGVDDVTVSATKGAFGHTLGAAG
AIEAVLTVLALRDRTAPPACSLERVDPEIGLNVVGRDPATLPCGPLAAVSTSMGFGGHNV
ALAFADAS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccacgacacgcggccggcccggcccccggggagcgggccgccgtcgtcacgggg
ctggggctgaccacctcgctgggcggcgacgtcccctccacctggcgggccctgctggac
ggcgggtgcggcgtcgaacgcgtcgacttcggcgagccggccgggcccgcacaggtgtac
ctcgcggccccggccgcggtcgaccccgggacggtcctgtcgtccgccaaggcggcgcac
tgcgaccgctcggcgcagttcgccctcgtggccgcccgcgaggccgttcgcgacgcgggg
ttccccgacccgtccgcgctcgccggggacgggtcgcgggtggccgtggtcgtcggggtg
gggctgggcggcctcaccagcgtcctggagcaggaccaccgcctgcggacgcagggcgcg
gggcgggtgagcccgcgcaccatcccggtcatgctgcccaaccacgcggccgccgaagtg
gggctcatggtgggcgcgaaggccggggtgcacgcgcccgtcagtgcctgcgccgccggt
gccgaggccctcgcccaggccctcggcatgatccgggacggccgcgcggacatcgtggtc
gcgggcggcaccgaggccgcgctgcatccgctggtcctggccgggttcgcgcggctgcgg
gccctctcccggcgccacgacgatcccaagggggcctccaggcccttcgacgccgaccgg
gacggcttcgtgatgggggagggcgccggcatgctcgtggtcgagagcgccgcgcacgcc
gccgcccgcggcgcccgcgtccacggccggctcaccggggcgggcatcaccaacgacagc
caccacgtggcccagccggcgcccggcggtccgggctgcgcggcggccgtcgacgccgca
ctgcgcgacgcggggctcgtgccggagcagatccagcacgtcaacgcccacgccaccgcc
acaccgctcggcgacctcggcgaggcgcaggcgctgcacagcgtcttcgccaagggcgtg
gacgacgtcacggtcagcgccaccaagggggccttcggacacaccctcggtgccgccgga
gccatcgaggccgtcctcaccgtcctcgccctgcgggacagaacggcaccgccggcctgc
agcctcgaacgggtcgaccccgagatcggcctgaacgtcgtcggccgcgacccggcgaca
ctgccctgcgggcccctcgcggccgtcagcacgagcatgggcttcggcgggcacaacgtc
gcgctcgccttcgccgacgcctcatga

DBGET integrated database retrieval system