KEGG   Streptomyces coelicolor: SCO0560Help
Entry
SCO0560           CDS       T00085                                 

Gene name
cpeB
Definition
(RefSeq) catalase/peroxidase
  KO
K03782  
catalase-peroxidase [EC:1.11.1.21]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO0560 (cpeB)
   00380 Tryptophan metabolism
    SCO0560 (cpeB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     SCO0560 (cpeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(601133..603355)
Genome map
AA seq 740 aa AA seqDB search
MSENHDAIVTDAKTEETDGCPVAHGRAPHPTQGGGNRQWWPERLNLKILAKNPAVANPLG
EEFDYAEAFEALDLAAVKRDIAEVLTTSQDWWPADFGNYGPLMIRMAWHSAGTYRISDGR
GGAGAGQQRFAPLNSWPDNGNLDKARRLLWPVKKKYGQNLSWADLLVLTGNVALETMGFE
TFGFAGGRADVWEAEEDVYWGPETTWLDDRRYTGDRELENPLGAVQMGLIYVNPEGPNGN
PDPIAAARDIRETFRRMAMNDEETVALIAGGHTFGKTHGAGPADAVGDDPEAAAMEQQGL
GWKSTHGTGKGGDAITSGLEVTWTSTPTQWGNGFFKNLFEFEYELEQSPAGANQWVAKDA
PEIIPDAHDPAKKHRPRMLTTDLSLRLDPIYGPISRRFYENPEEFADAFARAWFKLTHRD
MGPKSLYLGPEVPEETLIWQDPLPEPEGEVIDAEDVATLKTKLLESGLSVSQLVTTAWAS
ASTFRGSDKRGGANGARIRLEPQRGWEVNEPDELAQVLRVLEGVQREFNSGSGAKKVSLA
DLIVLGGSAAVEKAAKEAGFPVEVPFAAGRVDATEEHTDAESFEALEPTADGFRNYLGKG
NRLPAEFLLLDRANLLTLSAPEMTVLVGGLRVLGAGHQQSQLGVFTRTPGSLTNDFFVNL
LDLGTTWKSTSEDRTTFEGRDAATGEVKWAGSRADLVFGSNAELRALAEVYASDDAGEKF
VHDFVAAWVKVMNLDRFDLA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaaccacgacgccatcgtgaccgacgcgaagaccgaggagacggacggctgc
ccggtcgcccacggacgcgccccgcaccccacgcagggcggcggaaaccgtcagtggtgg
ccggagcggctcaacctgaagatcctcgccaagaaccccgccgtcgccaacccgctgggt
gaggagttcgactacgccgaggccttcgaggccctcgacctcgcggccgtgaaacgggac
atcgccgaggtgctgaccacctcgcaggactggtggcccgccgacttcggcaactacggc
ccgctgatgatccggatggcctggcacagcgcgggcacctaccgcatcagcgacggccgc
ggcggcgcgggcgccggccagcagcgcttcgccccgctcaacagctggcccgacaacggc
aacctggacaaggcccgccgcctgctgtggccggtcaagaagaagtacggccagaacctc
tcctgggccgacctgctggtcctcaccggcaacgtcgcgctggagacgatgggcttcgag
accttcggcttcgccggcggccgcgccgacgtgtgggaggccgaggaggacgtctactgg
ggccccgagaccacctggctcgacgaccggcgctacaccggcgaccgcgagctggagaac
ccgctcggcgccgtccagatgggtctgatctacgtcaacccggagggccccaacggcaac
ccggacccgatcgccgccgcccgcgacatccgcgagaccttccgccgcatggcgatgaac
gacgaggagaccgtcgcgctcatcgccggcggacacaccttcggcaagacccacggcgcg
ggcccggccgacgccgtcggcgacgaccccgaggccgccgccatggagcagcagggcctc
ggctggaagagcacccacggcacgggcaagggcggcgacgccatcacctccggcctggag
gtcacctggaccagcacgcccacccagtggggcaacggcttcttcaagaacctcttcgag
ttcgagtacgagctggagcagagcccggccggcgccaaccagtgggtcgccaaggacgca
ccggagatcatccccgacgcgcacgacccggccaagaagcaccgccccaggatgctcacc
accgacctgtcgctgcgcctcgacccgatctacgggccgatctcccgccggttctacgag
aacccggaggaattcgcggacgccttcgcccgcgcctggttcaagctgacccaccgcgac
atgggcccgaagtccctgtacctcggcccggaggtccccgaggagaccctgatctggcag
gacccgctgcccgagcccgagggcgaggtcatcgacgccgaggacgtcgccaccctcaag
accaagctcctcgagtccggcctgtcggtgtcgcagctggtgaccaccgcgtgggcatcg
gcgtccaccttccgcgggagcgacaagcgcggcggtgccaacggcgcccgcatccgcctc
gaaccgcagcgcggctgggaggtcaacgagcccgacgagctggcgcaggtgctgcgcgtc
ctggagggtgtccagcgggagttcaactccgggtccggcgccaagaaggtctccctggcc
gacctgatcgtcctcggcggctcggccgcggtcgagaaggccgccaaggaagccggcttc
ccggtggaggtccccttcgccgcgggccgcgtggacgcgacggaggagcacaccgacgcc
gagtcgttcgaggccctcgaaccgaccgccgacgggttccgcaactacctgggcaaggga
aaccggctgcccgccgagttcctgctcctcgaccgggcgaacctgctcaccctgagcgcg
cccgagatgaccgtcctggtcggcggcctgcgcgtgctgggcgcgggacaccagcagtcc
cagctcggcgtcttcacccgcacgcccggctcgctgaccaacgacttcttcgtcaacctg
ctcgacctgggcaccacctggaagtcgacgtccgaggaccggaccaccttcgagggccgc
gacgccgccaccggcgaggtcaagtgggccggcagccgcgccgacctggtcttcggctcc
aacgccgagctgcgggcgctcgccgaggtctacgcgagcgacgacgcgggcgagaagttc
gtgcacgacttcgtcgccgcctgggtgaaggtcatgaacctcgaccgtttcgacctggcc
tga

DBGET integrated database retrieval system