KEGG   Streptomyces coelicolor: SCO0572Help
Entry
SCO0572           CDS       T00085                                 

Gene name
SC5G5.04c
Definition
(RefSeq) cytosine permease
  KO
K10974  
cytosine permease
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO0572 (SC5G5.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(613751..615151)
Genome map
AA seq 466 aa AA seqDB search
MAMHKNPAGGAAAAEAATGAVGSDDYALSRVPRDKRLGFWTMLLQWLAQSGSISQFTLGA
TIGVGMTFGDAFLAFTLGAVILEVVIFAIGLAGMREGLATPLLTRWAGFGRNGSALVSLV
ISVSLVGWFGVQNTIFGDSVSALVGGPSWLWCTAAGVAITVLVIFGFKYMAVFAKIVTPL
FFAMVAWSVTDALSDHSFSELIHSPAPGETIPLAVAATAIAGGFMTGAIVSPEMTRYNRK
GSHVFLQSASSMILSEYIVGLTGVLLGHLVGSGQVSQIVLSTSGVFGVLVVLMSTAKIND
WNLYGSSLGVVNFFQVVFGKRVHRGAVTIVLGIAGTLLSAVGIMTHFTDFLSVLGVAIPP
VGGIIVAEYWVVRRMRAPLDATRDAETLPATSPTWVPMSLVIWAAAFCVGKFYDGGIPAL
NSLLTAFVLYCVLGLAGWIRPYGTTALDDTDEPTPAATGTATVGAP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcacaagaaccccgccggcggggccgccgccgcggaagcggccacgggagcc
gtgggcagcgacgactacgccctctcccgcgtcccgcgcgacaagcggctcggcttctgg
accatgctgctgcagtggctcgcgcagtccggctccatctcgcagttcaccctcggcgcc
accatcggcgtcggcatgaccttcggcgacgccttcctcgcgttcaccctcggcgcggtg
atcctcgaagtcgtgatcttcgcgatcggcctcgcgggcatgcgcgaggggctcgccacc
ccgctgctcacccgctgggcgggcttcggccgcaacggctccgcgctggtcagcctggtc
atctcggtcagcctcgtcggctggttcggggtgcagaacacgatcttcggcgacagcgtg
tccgcgctcgtcggcggtccctcctggctgtggtgcacggccgccggtgtcgccatcacg
gtgctggtcatcttcggcttcaagtacatggccgtcttcgcgaagatcgtcacgccgctg
ttcttcgccatggtcgcctggtcggtcaccgacgcgctgagcgaccactcgttctccgaa
ctgatccactccccggcgcccggcgagaccatcccgctcgccgtcgccgcgaccgccatc
gcgggcggcttcatgaccggcgcgatcgtctccccggagatgacccggtacaaccgcaag
ggcagccacgtcttcctgcagagcgcctcgtcgatgatcctctccgagtacatcgtcggc
ctgaccggtgtcctgctcggccacctggtcggcagcggccaggtctcccagatcgtgctc
tccacctccggcgtcttcggcgtgctcgtcgtcctgatgtccaccgcgaagatcaacgac
tggaacctgtacggctcctcgctcggcgtcgtcaacttcttccaggtcgtcttcggcaag
cgcgtgcaccggggcgcggtcaccatcgtcctcggcatcgcgggcaccctgctctccgcc
gtcggcatcatgacccacttcaccgacttcctgtccgtgctgggcgtcgccatcccgccg
gtgggcggcatcatcgtcgccgagtactgggtggtgcgccgcatgcgggcacccctggac
gccacccgcgacgcggagaccctgccggccacctcgccgacctgggtgcccatgtccctg
gtcatctgggcggccgccttctgcgtcggcaagttctacgacggcggcatccccgccctg
aactccctgctgaccgccttcgtcctctactgcgtcctcggcctcgccggctggatcagg
ccatacggcaccaccgccctggacgacaccgacgaacccaccccggccgccaccggcacg
gccaccgtaggagcaccgtga

DBGET integrated database retrieval system