KEGG   Streptomyces coelicolor: SCO0579Help
Entry
SCO0579           CDS       T00085                                 

Gene name
SCF55.03c
Definition
(RefSeq) ribose 5-phosphate isomerase
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0579 (SCF55.03c)
   01230 Biosynthesis of amino acids
    SCO0579 (SCF55.03c)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0579 (SCF55.03c)
   00051 Fructose and mannose metabolism
    SCO0579 (SCF55.03c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SCO0579 (SCF55.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(620367..620879)
Genome map
AA seq 170 aa AA seqDB search
MTDKLRIVVGSDDAGHQYKEALKQDLRGSALVAEVTDVGVDADGHTAYPKVAIAAAEMVA
RGEADRALLVCGTGLGVAIAANKVRGIRAVTAHDSFSVERAILSNNAQVLTFGQRVVGLE
LARRLAAEWLTYRFDENSASAAKVQLMSDYETADDAGAASGSAADGGAAA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagctccgcatcgtcgtcggctccgacgacgccggccaccagtacaaggaa
gccctcaagcaggacctgcgcggcagcgccctggtcgccgaggtcaccgacgtcggcgtc
gacgccgacggccacaccgcctacccgaaggtggccatcgccgccgccgagatggtcgcc
cggggcgaggccgaccgcgccctgctggtgtgcggcaccggcctcggcgtcgccatcgcc
gccaacaaggtcaggggcatccgggccgtcaccgcccacgactccttctccgtcgagcgg
gcgatcctctccaacaacgcccaggtcctcaccttcggccagcgcgtcgtcggcctcgaa
ctcgcccgccgcctcgccgccgagtggctcacctaccgcttcgacgagaactcggcgtcg
gccgccaaggtccagctgatgagcgactacgagaccgccgacgacgccggtgcggcgagc
gggagcgcggccgacggcggggcggccgcctga

DBGET integrated database retrieval system