KEGG   Streptomyces coelicolor: SCO0666Help
Entry
SCO0666           CDS       T00085                                 

Gene name
catB
Definition
(RefSeq) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0666 (catB)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0666 (catB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCO0666 (catB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCO0666 (catB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
704114..706393
Genome map
AA seq 759 aa AA seqDB search
MSEANPLKRVARKVTEGLHGEAGGPPDGIPGRPGPESPSAAEPTEPREPLPPKPDQTGPD
TVSPTGQPTGADQARVAQSGSYLTNAQGTRLYDTDHSLKAGPRGPVLLQDHHLREKVMHF
DHERIPERVVHARGAGAHGVFQSYGTAASVTKAGFLAADVETPVFTRFSTVVGSRGSSDT
VRDTRGFATKFYTSEGVFDLVGNNIPVFFIQDAIKFPDVVHAAKPHPDREIPQAQSAHDT
FWDFVSLHTEATNHTIFFMGDRGIPRSFRMMEGFGVHTFRLVNAEGATTLVKFHWKPKLG
VHSLVWDEAQLINGVDPDFHRRDLADAIEAGAYPQWELGIQTFPDNPEQTFEGIDLLDPT
NFVPEELAPVQPVGLLTLNRNPSNFFAETEQVAFHVGHLVPGIDVTDDPLLAGRLFSYLD
TQITRLGGPNFPQLPINRPQAPVNDMLRDGMHQSAVHRGVAPYRPNSLDGGCPFTAGADT
SAFVEAPVRVPEGRKVREASESFADHFSQPRRFWLSMSPVEREHIIGAYTFELGKCYEQA
IRERTLQVLANIDPELCAGVAEGLGLPAPEPTVPLAEVEPSPALSQVGGVWPLDGRVVGI
VTGGADLEGVGAVREAVLNAGMVPLVVAPTGGTLGSGDAALTVQRSYVTARSVEFDAVLI
AGTPDMGGDAYTPRDYKAGPAPAGPGTVDPRVSLLLSEAFRHGKAIGVWAGGTPALEASG
VPADAPGVIVADSGTAALERVTELMGSHRVWERFTTPRG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggccaaccccctcaagcgagtagcccgcaaggtgaccgagggcctgcacggc
gaggccggcgggccgccggacgggatccccggcaggccaggccccgagtcgccctccgcc
gccgaacccaccgagccccgcgagccgctgcccccgaagccggaccagaccggtccggac
accgtgtccccgaccggtcagcccacgggcgccgaccaggcccgggtggcgcagtccggc
agctacctgacgaacgcccaggggacccggctgtacgacaccgaccactcgctgaaggcc
gggccgcgcggtcccgtgctgctccaggaccaccacctgcgcgagaaggtcatgcacttc
gaccacgagcgcatcccggagcgcgtggtccacgcgcggggcgcgggcgcccacggggtc
ttccagagctacggcacggcggcctcggtgaccaaggccgggttcctggccgcggacgtg
gagacgccggtgttcacccggttctccacggtggtcggctcgcgcggttcgtcggacacc
gtgcgggacacccgggggttcgcgacgaagttctacaccagtgagggcgtcttcgacctg
gtcggcaacaacatcccggtcttcttcatccaggacgccatcaagttcccggacgtggtg
cacgcggcgaagccgcacccggaccgggagatcccgcaggcgcagagcgcgcacgacacc
ttctgggacttcgtctcgctgcacaccgaggcgacgaaccacaccatcttcttcatgggc
gaccggggtatcccgcgctcgttccggatgatggagggcttcggcgtccacaccttccgg
ctggtgaacgcggagggcgccacgacgctggtgaagttccactggaagccgaagctgggt
gtgcactccctggtgtgggacgaggcgcagctgatcaacggcgtcgacccggacttccac
cgccgggacctcgcggacgcgatcgaggcgggcgcgtacccgcagtgggagctgggcatc
cagaccttcccggacaacccggagcagaccttcgagggcatcgacctgctggacccgacc
aacttcgtgccggaggagctggcgccggtgcagccggtcgggctgctgaccctgaaccgc
aacccgtccaacttcttcgccgagaccgagcaggtcgccttccacgtcggtcacctggtg
cccggtatcgacgtcaccgacgacccgctgctcgcggggcggctgttctcgtacctggac
acgcagatcacgcggctgggcggtcccaacttcccgcagctgccgatcaaccggccgcag
gcgccggtcaacgacatgctgcgtgacggcatgcaccagagcgccgtgcaccggggcgtg
gcgccgtaccggcccaactccctggacggcggctgcccgttcaccgcgggcgcggacacc
agcgcgttcgtcgaggccccggtgcgggtgccggaggggcgcaaggtccgcgaggcctcc
gagtcgttcgcggaccacttcagccagccgcgccgcttctggctgagcatgagcccggtg
gagcgcgagcacatcatcggcgcctacaccttcgagctgggcaagtgctacgagcaggcg
atccgggagcgcacgctccaggtcctggccaacatcgaccccgagctgtgcgcgggggtc
gccgagggcctcggcctgcccgccccggaaccgacggtcccgctggccgaggtcgagccc
agcccggcgctgtcccaggtgggcggcgtctggccgctggacggcagggtcgtcggcatc
gtgaccggcggggcggacctggagggcgtgggcgcggtacgggaggccgtgctgaacgcc
gggatggtgccgctggtcgtggcgccgaccggcggcaccctgggctccggcgacgccgcg
ctgaccgtgcagcgcagctatgtcaccgcgcggtcggtcgagttcgacgcggtgctgatc
gcggggacgcccgacatgggcggcgacgcgtacacgccgcgcgactacaaggccgggccg
gcgcccgcggggccggggacggtcgacccgcgggtgagcctgctgctgtcggaggcgttc
cggcacggcaaggcgatcggcgtctgggccggtggcacgccggcgctggaggcgtcgggg
gtgcccgccgacgccccgggtgtgatcgtcgccgactccggcaccgccgccctggaacgg
gtgacggagctgatgggctcgcaccgggtgtgggaacgcttcaccacgccgcggggctga

DBGET integrated database retrieval system