KEGG   Streptomyces coelicolor: SCO0670Help
Entry
SCO0670           CDS       T00085                                 

Gene name
glpD, SCF91.30
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00564  Glycerophospholipid metabolism
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO0670 (glpD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCO0670 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1096093
NCBI-ProteinID: NP_624979
Kitasato: SCO0670
UniProt: Q9RJ95
Position
709685..711268
Genome map
AA seq 527 aa AA seqDB search
MSPTSRPATGASLSAARRSREVADTVGGPVVDVLVVGLGATGAGAALDAAARGLGVVAVD
AHDLAFGTSRWSSKLIHGGLRYLASGQLDVAHESAVERGVLMERTAPHLVRAQPFVLPLT
PLVSRGQGALAWAGFRAGDTLRLAARTARATLPAPRRLSAVETRHLAPALRSDRLRGGLL
SWDGRLADDARLVTALARTAAARGARILTRVRALELTGSGARVRDETTGEEGVIRARAVV
NASGVWAGDLVDGIRIRPSRGTHLVLRSDRLGPLPAGLHVPIPGETNRFVLVLPQDDGRV
YVGLTDEPVDGDVPDVPEVPETDVGFLLDVLGSVLDVPVHREDVVGAFAGLRPLLDTAPS
DRPGAAPRTADVSRRHAVLTSSEGVITVVGGKLTTYRRMAEDAVDAAVAARGLAAGPSPT
AALPLVGAAAPHTLAGVRAPRRLVRRYGTEAPAVQALASREPCLAERVLPGHPVTGAELV
WALRHEGALDEADLLDRRTRVGLVPEDRAAALGAVRDLVGEVTADPR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaccagccgccccgccaccggggcctccctgtccgccgcgcggcgctcgcgc
gaggtggccgacaccgtcggcggccccgtggtggacgtcctggtcgtcggtctcggcgcg
accggtgccggtgccgcgctggacgccgccgcccggggactgggcgtcgtcgccgtggac
gcccacgacctggccttcggcacctcccgctggagctccaagctcatccacggcggactg
cgctacctcgcctccggccagctcgacgtcgcgcacgagagcgcggtggaacgcggggtg
ctgatggagcgcacggcaccccacctggtgcgcgcccagccgttcgtgctgccgctcacc
ccgctggtctcccgcggccagggcgcgctggcgtgggccgggttccgggccggggacacc
ctgcgtctcgcggcgcgcaccgcacgggccaccctgcccgcgccgcgccggctgtccgcg
gtggagacccgtcacctcgcaccggcgctgcgctccgaccggctgcgcggcgggctgctc
tcctgggacggcaggctcgccgacgacgcccggctggtgaccgcgctcgcccggaccgcg
gcggcccgcggcgcgcggatccttacccgggtcagggcactggagctgaccgggtcgggc
gcccgggtccgcgacgagacgaccggcgaggagggcgtgatccgggcccgcgcggtggtc
aacgcctccggggtgtgggccggagacctcgtggacggcatccggatccgtccctcccgc
ggcacgcatctcgtcctgcgctccgaccgcctcggccccctcccggccggcctgcacgtg
ccgatccccggcgagaccaaccgcttcgtcctcgtcctgccccaggacgacggccgcgtc
tacgtcggcctcaccgacgagccggtggacggggacgtcccggacgtgccggaggtcccg
gagaccgacgtcggcttcctgctcgacgtgctcggttcggtgctcgacgtgccggtgcac
cgcgaggacgtggtgggcgccttcgcgggcctgcgccccctgctcgacaccgccccgtcg
gaccggcccggcgccgcgccccgtacggcggacgtctcgcgccggcacgccgtgctgacc
tcgtccgagggtgtgatcaccgtggtcggcggcaagctcaccacgtaccggcggatggcc
gaggacgccgtggacgccgccgtcgccgcccggggcctcgccgcgggaccgtcccccacc
gccgcgctgcccctggtcggcgccgccgccccgcacaccctggccggggtccgggcaccg
cgccgcctggtgcggcgctacggcaccgaggcccctgcggtccaggccctcgcctcccgg
gagccctgcctcgccgaacgcgtactgcccggccaccccgtcaccggcgcggaactggtg
tgggccctgcgccacgagggcgccctcgacgaggccgacctgctcgaccggcgcacccgc
gtcggcctggtccccgaggaccgcgcggcggccctgggcgccgtacgtgacctcgtcggc
gaggtcacggcggacccgcgctga

DBGET integrated database retrieval system