KEGG   Streptomyces coelicolor: SCO0681Help
Entry
SCO0681           CDS       T00085                                 

Gene name
SCF15.02
Definition
(RefSeq) ferredoxin/ferredoxin-NADP reductase
  KO
K00528  
ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     SCO0681 (SCF15.02)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     SCO0681 (SCF15.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
723181..724545
Genome map
AA seq 454 aa AA seqDB search
MPRPLRVAIVGSGPAGIYAADALLKSEVAADPGVSIDIFERMPAPFGLIRYGVAPDHPRI
KGIITALHQVLDKPQIRLFGNVNYPTDVSLDDLRAFYDGVIFATGATADRDLSLPGIDLD
GSYGAADFVAWYDGHPDFPRTWPLEAEKVAVLGVGNVALDIARVLAKTADELLPTEIPPN
VYEGLKANKALEVHVFGRRGPAQAKFSPMELRELDHSPNIEVIVDPEDIDYDEGSIATRR
GNKQADMVAKTLENWAIRDVGDRPHKLFLHFFESPAEILGEDGRVTGLRTERTELDGTGN
VKGTGEFKDWDVQAVYRAVGYLSDQLPKLPWDLETGTVPDAGGRVVQESGEHLQSTYVTG
WIRRGPIGLIGHTKGDANETVSNLLDDYANGRLQTPSSPAPEAVDAFLAERNVRFTTWDG
WYRLDAAEKAQGEPHGRERVKYVEREDMLRESGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccctctgcgggtagccatcgtcggatccggcccggccgggatctacgccgcc
gacgccctgctcaagtccgaagtggccgccgaccccggtgtttccatcgacatcttcgag
cgcatgcccgccccgttcggcctcatccggtacggcgtcgcgcccgaccacccgcggatc
aagggcatcatcacggccctccaccaggtgctcgacaagccgcagatccgcctcttcggc
aacgtgaactaccccaccgacgtcagcctggacgatctgcgcgccttctacgacggtgtg
atcttcgccaccggcgccacggcggaccgggacctgtccctcccgggcatcgacctcgac
ggctcgtacggcgcggccgacttcgtcgcctggtacgacggccaccccgacttcccgcgc
acctggccgctggaggcggagaaagtcgccgtcctcggtgtcggcaacgtcgccctggac
atcgcgcgcgtcctcgccaagacggccgacgagctgctgccgaccgagatcccgccgaac
gtctacgagggcctcaaggccaacaaggcgctggaggtgcacgtcttcggccgccgcggc
ccggcgcaggcgaagttcagcccgatggagctgcgggagctggaccactcccccaacatc
gaggtgatcgtcgaccccgaggacatcgactacgacgagggctcgatcgcgacccggcgc
ggcaacaagcaggccgacatggtcgccaagaccctggagaactgggcgatccgcgacgtc
ggcgaccggccgcacaagctcttcctgcacttcttcgagtcgcccgcggagatcctcggc
gaggacggcagggtgaccggcctgcgcaccgagcgcacggagctggacggcacgggcaac
gtcaagggcaccggcgagttcaaggactgggacgtccaggcggtctaccgggccgtcggc
tacctctccgaccagctgcccaagctgccctgggacctcgagacgggcacggtcccggac
gcgggcggccgggtcgtccaggagtccggcgagcacctccagtcgacgtacgtcaccggc
tggatccggcgcggtccgatcggcctgatcggccacaccaagggcgacgccaacgagacg
gtgtccaacctgctggacgactacgcgaacggccgtctccagacgccctcctcccccgct
cccgaggccgtggacgcgttcctcgccgagcggaacgtccgcttcaccacctgggacggc
tggtaccggctcgacgccgcggagaaggcgcagggcgaaccgcacgggcgtgagcgcgtg
aagtacgtcgagcgcgaggacatgctccgcgagagcggcgcctga

DBGET integrated database retrieval system