KEGG   Streptomyces coelicolor: SCO0782Help
Entry
SCO0782           CDS       T00085                                 

Gene name
3SCF60.14c, prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0782 (3SCF60.14c)
   01230 Biosynthesis of amino acids
    SCO0782 (3SCF60.14c)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0782 (3SCF60.14c)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO0782 (3SCF60.14c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     SCO0782 (3SCF60.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(828755..829708)
Genome map
AA seq 317 aa AA seqDB search
MRDIAVFSGSAHPDLAEEVCAQLGVPLSPTRVSRFANDCLEVQLMANCRERDVFLVQPLV
TPVQEHLVELLMMCDAARGASAGRITVVMPHYSYARSDKKDAPRISLGGRLVADLLVAAG
ASRVLAMTLHSPQVHGFFSVPVDHLHALRELAAHFRQYDLSRATVVSPDLGNAKEAAAFA
RMLGAQVAAGAKQRYADDRVSISSVIGDVAGRDVIVLDDEIAKGSTVLELLDRLRESGPR
TIRLACTHGLFAAGALGRLSEQPDVLEIVCTNTVPVPADDHTDKLRILSIAPALAEAVRR
IHNGESVSALFDARPAG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagacatcgccgtgttcagcggtagtgcccaccccgacctggccgaggaggtctgc
gcgcagctgggcgtgccgctcagccccacccgggtcagccggttcgccaacgactgcctc
gaggtgcagctgatggccaactgccgcgagcgggacgtgttcctcgtccagccgctggtc
acaccggtccaggagcacctcgtcgagctgctgatgatgtgcgacgcggcccgcggggcg
tcggccggccgcatcacggtggtcatgccgcactactcctacgcccgctccgacaagaag
gacgccccgcgcatctcgctgggcgggcgcctggtcgccgacctgctggtggcggcgggg
gcgagccgggtcctcgccatgaccctgcactcgccccaggtgcacggcttcttctccgtc
ccggtcgaccacctgcacgcgctgcgggaactggccgcgcacttccggcagtacgatctc
tcccgcgcgaccgtcgtctcgccggacctgggcaacgccaaggaggccgcggcgttcgcc
cggatgctcggcgcccaggtggcggccggggcgaagcagcggtacgccgacgaccgggtc
agcatcagctcggtgatcggggacgtcgcgggccgggacgtcatcgtgctcgacgacgag
atcgccaagggcagcacggttctggaactcctcgaccggctccgggagtcgggcccgcgc
accatccgcctcgcctgtacgcacgggctgttcgcggccggtgcgctgggccgcctcagc
gagcagccggacgtgctggagatcgtgtgcaccaacaccgtgccggtcccggcggacgac
cacacggacaaactgcggatcctgtccatcgccccggcgctcgccgaggcggtgcgccgc
atccacaacggcgagtcggtcagcgccctgttcgacgcccggccggccggctga

DBGET integrated database retrieval system