KEGG   Streptomyces coelicolor: SCO0812Help
Entry
SCO0812           CDS       T00085                                 

Gene name
SCF43A.02
Definition
(RefSeq) sugar isomerase
  KO
K01820  
L-rhamnose isomerase / sugar isomerase [EC:5.3.1.14 5.3.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO0812 (SCF43A.02)
   00051 Fructose and mannose metabolism
    SCO0812 (SCF43A.02)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.14  L-rhamnose isomerase
     SCO0812 (SCF43A.02)
    5.3.1.-  
     SCO0812 (SCF43A.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
859963..861123
Genome map
AA seq 386 aa AA seqDB search
MTELAAVKAALKTQAVETPSWAYGNSGTRFKVFAQPGVPRDPFEKLDDAAKVHEFTGAAP
TVALHIPWDRVEDYAALAAHAEKRGVRIGAINSNTFQDDDYRLGSICHPDAAVRRKAVDH
LLECVDIMDATGSRDLKLWFADGTNYPGQDDIRSRQDRLAEGLAEVYERLGEGQRMLLEY
KLFEPAFYTTDVPDWGTAYAHCLKLGEKAQVVVDTGHHAPGTNIEFIVATLLREGKLGGF
DFNSRFYADDDLMVGAADPFQLFRIMYEVVRGGGFTSDVAFMLDQCHNIEAKIPAIIRSV
MNVQEATAKALLVDGTALAEAQAAGDVLEANAVLMDAYNTDVRPLLREVREESGLDPEPM
KAYRSCGWAEKVVAERIGGQQAGWGA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctcgccgcggtgaaagccgcgctcaagacccaggccgtcgagacgccgtcg
tgggcgtacggcaactcgggcacccgcttcaaggtgttcgcccagcccggtgtcccgcgc
gaccccttcgagaaactggacgacgcggcgaaggtgcacgagttcaccggcgcggccccg
accgtcgccctgcacatcccgtgggaccgggtcgaggactacgccgcgctggcggcgcac
gccgagaagcggggcgtgcggatcggcgcgatcaactccaacaccttccaggacgacgac
tacaggctgggcagcatctgccaccccgacgcggcggtgcgccggaaggccgtcgaccac
ctgctggagtgcgtcgacatcatggacgccaccggctcgcgcgacctgaagctgtggttc
gccgacggcacgaactacccgggacaggacgacatccggtcccggcaggaccggctggcc
gagggcctggccgaggtgtacgagcggctcggcgaggggcagcggatgctcctggagtac
aagctcttcgagccggcgttctacacgacggacgtgccggactggggcacggcgtacgcg
cactgtctcaagctgggcgagaaggcccaggtcgtggtcgacacgggacaccacgcgccg
ggcacgaacatcgagttcatcgtggcgacgctgctgcgggaggggaagctcggcgggttc
gacttcaactcgcggttctacgccgacgacgacctgatggtgggtgccgccgacccgttc
cagctgttccggatcatgtacgaggtggtgcgcgggggcgggttcacctccgacgtggcg
ttcatgctcgaccagtgccacaacatcgaggcgaagatcccggcgatcatccggtcggtg
atgaacgtgcaggaggcgacggcgaaggcgctgctggtcgacggcaccgccctggccgag
gcgcaggccgcgggggatgtgctggaggcgaacgcggtgctgatggacgcgtacaacacg
gacgtgcggccgctgctccgggaagtgcgggaggagtcggggctggaccccgaacccatg
aaggcgtaccgctcctgcgggtgggcggagaaggtcgttgccgagcggatcggtgggcag
caggccgggtggggggcgtag

DBGET integrated database retrieval system