KEGG   Streptomyces coelicolor: SCO0814Help
Entry
SCO0814           CDS       T00085                                 

Gene name
SCF43A.04
Definition
(RefSeq) rhamnose kinase
  KO
K00848  
rhamnulokinase [EC:2.7.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO0814 (SCF43A.04)
   00051 Fructose and mannose metabolism
    SCO0814 (SCF43A.04)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     SCO0814 (SCF43A.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
863278..864732
Genome map
AA seq 484 aa AA seqDB search
MSTAIDTKAFAAVDLGASSGRVMVGRVGADRLELTEAHRFPNRPVRTPDGLRWDVLALYA
GVLDGLRAAGRVDSVGVDSWAVDHGLLDADGVLLGNPVHYRDARTEGVAERVWASLPAGE
LYAATGLQYAPFNTLYQLVAARGTAQFAAARRLLLIPDLLTYWLTGEQGTELTNASTTQL
IDPRTRDWSREVADRLGIDLGLFAPLRRPGDPAGLLRPEVLEETGLAGPVPVTAVGSHDT
ASAVAAVPASGERFAYICTGTWSLAGLELSAPVLTQESRAANFTNELGLDGTVRYLRNIM
GLWLLQESVRAWGDPDLGELLLAAARVPALRSVVDAGDAGFLAPGRMPERIAEACRASGQ
PVPETPAEVTRCILDSLALAHRAAVGEAQRLAGHPVDVVHVVGGGTRNALLCQLTADACG
LPVVAGPTEAAALGNVLVQARAHGLVGDLAGMRRLVARTQSLTRYEPRGDPARWQAAAAR
LAHR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccatcgacaccaaggcgttcgccgcggtcgacctcggcgcgtccagcggg
cgcgtcatggtcggccgcgtcggcgccgaccggctggagctgaccgaggcgcaccgcttc
cccaaccggccggtccgtacgcccgacgggctgcgctgggacgtcctcgcgctgtacgcc
ggcgtgctggacggtctgcgggcggcgggccgggtggactcggtcggcgtggacagctgg
gccgtcgaccacggtctgctggacgcggacggggtgctgctcggcaaccccgtgcactac
cgcgacgcccgcacggagggcgtcgcggagcgggtgtgggcctcgctgcccgccggggag
ctgtacgcggcgacggggttgcagtacgcgcccttcaacaccctgtaccagctcgtcgcc
gcccggggcacggcccagttcgcggcggcccggcggctgttgctcatccccgacctgctg
acctactggctgaccggtgagcagggcacggagctgaccaacgcctccacgacccagctg
atcgacccccgcacccgggactggtcacgggaggtcgcggaccggctggggatcgacctc
ggcctgttcgcgccgctgcgccggcccggggacccggcggggctgctgcggccggaggtg
ctggaggagacgggactggcggggcccgtgccggtgacggccgtcggttcgcacgacacc
gcctccgcggtcgccgccgtaccggcatcgggcgaacggttcgcctacatctgcaccggc
acctggtcgctggccgggctcgaactgtccgctcccgtgctgacccaggagagccgggcc
gccaacttcaccaacgagctggggctggacggcacggtccgatacctgcgcaacatcatg
gggctgtggctgctccaggagtccgtgcgggcctggggcgacccggacctgggtgagctg
ctgctcgcggcggcgcgcgtgccggcgctgcggtcggtggtggacgcgggtgacgcgggg
ttcctggcgccggggcggatgccggagcggatcgccgaggcgtgccgcgcctcggggcag
ccggtgcccgagacgcccgccgaggtgacccggtgcatcctcgactcgctggcgctggcc
caccgcgcggccgtcggggaggcgcagcggctcgccgggcatccggtcgacgtcgtgcac
gtcgtcggcggcggcacccgcaacgcgctgctgtgccagctgaccgccgacgcctgcggg
ctgccggtggtggcggggccgacggaggccgccgcgctcggcaacgtgctggtgcaggcc
cgcgcccacggcctggtcggcgacctcgccgggatgcgccggctggttgcgcgcacccag
tcgctgacccggtacgaaccgcgcggcgacccggcgcgctggcaggcggccgcggcccga
ctcgcccaccggtga

DBGET integrated database retrieval system