KEGG   Streptomyces coelicolor: SCO0828Help
Entry
SCO0828           CDS       T00085                                 

Gene name
SCF43A.18
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SCO0828 (SCF43A.18)
   00790 Folate biosynthesis
    SCO0828 (SCF43A.18)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCO0828 (SCF43A.18)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO0828 (SCF43A.18)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SCO0828 (SCF43A.18)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO0828 (SCF43A.18)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sco00537]
 Enzymes
  SCO0828 (SCF43A.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
875839..877500
Genome map
AA seq 553 aa AA seqDB search
MAPTGRPSALAEHAFSPHDAVLGAAARHLGRRRFLTVTAAAAALAFSTNLPARGAVAAPE
RTARISKDPFTLGVASGDPLPDSVLLWTRLAPEPFLEDGGMGTDRVTVEWEVALDEYFAG
VLFRGTADAHAEYNHSVHVDVKGLTPGTVYYYRFRAGAWLSPAGRTRTAPAAGSATSSLK
LAAVACQAYMDGYYTVLRHVAQDDVDVVFHLGDYLYEYAVNSEGGERRYTDVTLPDVFNR
ETMTLADYRLRYSLYKTDEDLRAAHARHPFVVAWDDHETENNYAGSTPENDIPPSEFLLR
RAAAYRAYWENQPLRAAQLPQGPDARLYRRLHWGTLAQFDILDTRQYRSDQAYDDRPHAP
GAESDDPARTITGAEQEQWLLDGWKGSTALWNVMPQQVCFSQRKFDVTADAALSMDAWDG
YRASRGRVVAGAKAAGVDNWLILTGDVHVGYALDVKEDFDDPASATVGTEVTCTSVASGR
DGVEKPANWDLFMQANPHMKFYNGKRGYVRAELGRQATRLDFKTVSAISTPGAAVTTAAS
FVTEAGEPGLKPA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgggccgacccagcgcactggccgagcacgccttctccccccacgacgcc
gtgctgggcgccgccgcccggcacctcggccgaaggcgcttcctcaccgtgaccgcggcc
gccgccgcgctcgccttctccaccaacctcccggcccgcggcgcggtcgccgcgcccgaa
cgcaccgcccggatcagcaaggatcccttcaccctcggtgtcgcctccggcgacccgctg
ccggactcggtgctgctgtggaccaggctggcccccgagccgttcctggaggacggcggg
atgggcacggatcgggtcaccgtcgagtgggaggtggccttggacgagtacttcgcgggt
gtcctgttccgggggaccgccgacgcccacgccgagtacaaccacagcgtccacgtcgac
gtgaagggcctgacgcccgggaccgtctactactaccgcttccgcgccggtgcctggctc
agcccggcgggccgcacccgcaccgctccggcggcgggcagcgccacctcgtcgctgaag
ctcgcggcggtcgcctgccaggcctacatggacggctactacaccgtgctccgccacgtc
gcccaggacgacgtggacgtggtgttccacctcggcgactacctgtacgagtacgcggtg
aactccgagggcggggagcgccggtacaccgacgtcaccctgcccgacgtcttcaaccgc
gagacgatgaccctcgccgactaccggctgcgctactcgctctacaagaccgacgaggac
ctgcgggccgcgcacgcccggcatccgttcgtcgtcgcctgggacgatcacgagaccgag
aacaactacgcgggcagcaccccggagaacgacatcccgccgtccgagttcctgctgcgc
cgggccgccgcgtaccgcgcgtactgggagaaccagccgctgcgcgccgcccagctgccg
cagggtcccgacgcccggctgtaccgccggctgcactggggcacgctcgcccagttcgac
atcctggacacccgccagtaccgctccgaccaggcctacgacgaccggccgcacgccccc
ggcgccgagtcggacgatccggcgcgcaccatcaccggcgccgagcaggaacagtggctg
ctcgacggctggaagggctcgaccgcgctgtggaacgtgatgccccagcaggtgtgcttc
tcccagcgcaagttcgacgtgaccgccgacgccgcgctctccatggacgcctgggacggc
taccgggcctcgcgcggaagggtggtcgccggcgcgaaggccgccggggtcgacaactgg
ctgatcctcaccggcgacgtgcacgtgggctacgccctcgacgtcaaggaggacttcgac
gacccggcgtccgccacggtcggcaccgaggtcacctgcacctcggtggccagcggccgg
gacggcgtggagaagcccgccaactgggacctgttcatgcaggccaacccgcacatgaag
ttctacaacggcaagcgcggctacgtccgggccgaactcggccggcaggccacccgcctc
gacttcaagacggtctccgccatcagcacgcccggcgccgcggtgaccacggccgcgtcc
ttcgtcaccgaggcgggcgagccgggcctgaagcccgcctga

DBGET integrated database retrieval system