KEGG   Streptomyces coelicolor: SCO0828Help
Entry
SCO0828           CDS       T00085                                 

Gene name
SCF43A.18
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SCO0828 (SCF43A.18)
   00790 Folate biosynthesis
    SCO0828 (SCF43A.18)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO0828 (SCF43A.18)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SCO0828 (SCF43A.18)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO0828 (SCF43A.18)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sco00537]
 Enzymes
  SCO0828 (SCF43A.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
875839..877500
Genome map
AA seq 553 aa AA seqDB search
MAPTGRPSALAEHAFSPHDAVLGAAARHLGRRRFLTVTAAAAALAFSTNLPARGAVAAPE
RTARISKDPFTLGVASGDPLPDSVLLWTRLAPEPFLEDGGMGTDRVTVEWEVALDEYFAG
VLFRGTADAHAEYNHSVHVDVKGLTPGTVYYYRFRAGAWLSPAGRTRTAPAAGSATSSLK
LAAVACQAYMDGYYTVLRHVAQDDVDVVFHLGDYLYEYAVNSEGGERRYTDVTLPDVFNR
ETMTLADYRLRYSLYKTDEDLRAAHARHPFVVAWDDHETENNYAGSTPENDIPPSEFLLR
RAAAYRAYWENQPLRAAQLPQGPDARLYRRLHWGTLAQFDILDTRQYRSDQAYDDRPHAP
GAESDDPARTITGAEQEQWLLDGWKGSTALWNVMPQQVCFSQRKFDVTADAALSMDAWDG
YRASRGRVVAGAKAAGVDNWLILTGDVHVGYALDVKEDFDDPASATVGTEVTCTSVASGR
DGVEKPANWDLFMQANPHMKFYNGKRGYVRAELGRQATRLDFKTVSAISTPGAAVTTAAS
FVTEAGEPGLKPA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgggccgacccagcgcactggccgagcacgccttctccccccacgacgcc
gtgctgggcgccgccgcccggcacctcggccgaaggcgcttcctcaccgtgaccgcggcc
gccgccgcgctcgccttctccaccaacctcccggcccgcggcgcggtcgccgcgcccgaa
cgcaccgcccggatcagcaaggatcccttcaccctcggtgtcgcctccggcgacccgctg
ccggactcggtgctgctgtggaccaggctggcccccgagccgttcctggaggacggcggg
atgggcacggatcgggtcaccgtcgagtgggaggtggccttggacgagtacttcgcgggt
gtcctgttccgggggaccgccgacgcccacgccgagtacaaccacagcgtccacgtcgac
gtgaagggcctgacgcccgggaccgtctactactaccgcttccgcgccggtgcctggctc
agcccggcgggccgcacccgcaccgctccggcggcgggcagcgccacctcgtcgctgaag
ctcgcggcggtcgcctgccaggcctacatggacggctactacaccgtgctccgccacgtc
gcccaggacgacgtggacgtggtgttccacctcggcgactacctgtacgagtacgcggtg
aactccgagggcggggagcgccggtacaccgacgtcaccctgcccgacgtcttcaaccgc
gagacgatgaccctcgccgactaccggctgcgctactcgctctacaagaccgacgaggac
ctgcgggccgcgcacgcccggcatccgttcgtcgtcgcctgggacgatcacgagaccgag
aacaactacgcgggcagcaccccggagaacgacatcccgccgtccgagttcctgctgcgc
cgggccgccgcgtaccgcgcgtactgggagaaccagccgctgcgcgccgcccagctgccg
cagggtcccgacgcccggctgtaccgccggctgcactggggcacgctcgcccagttcgac
atcctggacacccgccagtaccgctccgaccaggcctacgacgaccggccgcacgccccc
ggcgccgagtcggacgatccggcgcgcaccatcaccggcgccgagcaggaacagtggctg
ctcgacggctggaagggctcgaccgcgctgtggaacgtgatgccccagcaggtgtgcttc
tcccagcgcaagttcgacgtgaccgccgacgccgcgctctccatggacgcctgggacggc
taccgggcctcgcgcggaagggtggtcgccggcgcgaaggccgccggggtcgacaactgg
ctgatcctcaccggcgacgtgcacgtgggctacgccctcgacgtcaaggaggacttcgac
gacccggcgtccgccacggtcggcaccgaggtcacctgcacctcggtggccagcggccgg
gacggcgtggagaagcccgccaactgggacctgttcatgcaggccaacccgcacatgaag
ttctacaacggcaagcgcggctacgtccgggccgaactcggccggcaggccacccgcctc
gacttcaagacggtctccgccatcagcacgcccggcgccgcggtgaccacggccgcgtcc
ttcgtcaccgaggcgggcgagccgggcctgaagcccgcctga

DBGET integrated database retrieval system