KEGG   Streptomyces coelicolor: SCO0852Help
Entry
SCO0852           CDS       T00085                                 

Gene name
SCM2.05c
Definition
(RefSeq) aldolase
  KO
K01625  
2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
   00030 Pentose phosphate pathway
    SCO0852 (SCM2.05c)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0852 (SCM2.05c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     SCO0852 (SCM2.05c)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     SCO0852 (SCM2.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(898034..898666)
Genome map
AA seq 210 aa AA seqDB search
MDLRAALAAHRLVAIVRGDDADAALRTVLTLAEEGVELIEVSLTGKDALQVIERARAALG
PDRPLGAGTVLSADDAVAAHRAGADFAVTPGLGEGVTAARERGMPVLAGVMTPTDVITAR
ALGATALKIFPAAQAGGPAYVKALRGPFPHETLVPVGGVDEAAARAHLAAGATAVGVGSP
LIGDAADGGSLDGLRTRARAFRAAVREMRP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgcgagctgccctggccgcacaccgcctcgtcgccatcgtgcgcggagacgac
gccgacgccgcgctgcgcaccgtgctgacgctggcggaggagggcgtggaactcatcgag
gtgtcgttgaccggcaaggacgccctccaggtcatagaacgcgccagagcggccctcggc
cccgaccggcccctgggcgccgggacggtcctcagcgcggacgacgcggtggccgcccac
cgggccggcgccgacttcgcggtcacgccggggctgggggagggggtcacggcggcccgc
gaacggggcatgcccgtcctggccggtgtcatgacgcccaccgacgtcatcaccgcgcgc
gccctcggcgccaccgcgctgaagatcttcccggcggcccaggcgggtggacccgcctac
gtgaaggcgttgcgcggccccttcccgcacgagaccctcgtgcccgtcggcggtgtcgac
gaggcggcggcccgtgcccatctggcggcgggtgccaccgcggtcggggtcggctccccg
ctgatcggcgacgccgcggacggaggcagcctcgacggcctccgcacccgtgcccgcgcc
ttccgcgccgccgtacgggagatgcggccgtga

DBGET integrated database retrieval system