KEGG   Streptomyces coelicolor: SCO0907Help
Entry
SCO0907           CDS       T00085                                 

Gene name
SCM1.40c
Definition
(RefSeq) dehydrogenase
  KO
K00020  
3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO0907 (SCM1.40c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     SCO0907 (SCM1.40c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(951968..952858)
Genome map
AA seq 296 aa AA seqDB search
MTDQLTVSVLGTGIMGAAMARNLARAGHAVRVWNRSRAKAEPLAADGAHVAGSPEEAVRG
ADVVLTMLYDGPAALDVMRRAEPGLRPGTVWAQSTTAGVDAVADLAAYAHERGLVFFDAP
VLGTRQPAEAGQLLVLAAGPGEARDTVAPVFDAVGSRTVWTGEDGAAGSATRLKLVANSW
VLAVTNAGGETLSLAKALGVDPDTFFDAIAGGPLDMGYLRAKAGLIRDGALRPAQFAVAT
AEKDARLIVEAGEANGVRLDLAAAGAERFARAAAQGHGDEDMAAAYFASFEEKASD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccagctcaccgtgagcgtcctgggcaccggcatcatgggtgccgcgatggcc
cgcaacctcgcccgcgccggacacgccgtccgcgtctggaaccgcagccgcgccaaggcc
gagccgctggccgccgacggcgcgcatgtcgcgggcagcccggaggaggcagtacgcggc
gccgacgtcgtcctcacgatgctgtacgacggcccggccgccctcgacgtgatgcggcgg
gccgagcccggcctgcggcccggcaccgtgtgggcgcagtccaccaccgcgggcgtcgac
gcggtcgccgacctggccgcctacgcccacgagcggggcctcgtcttcttcgacgccccc
gtcctcggcacccggcagcccgccgaggccggtcagctgctggtgctggcggcgggtccg
ggcgaggcgcgcgacaccgtggcgcccgtgttcgacgccgtcggctcgcgcaccgtgtgg
accggagaggacggcgcggccggcagcgccacccggctgaaactggtggccaacagctgg
gtcctcgccgtcaccaacgccggcggcgagaccctctcgctcgccaaggccctgggcgtc
gacccggacaccttcttcgacgccatcgccggtggtccgctcgacatgggctacctgcgg
gccaaggccggcctgatccgcgacggcgcgctgaggccggcccagttcgccgtcgccacc
gccgagaaggacgcccgcctgatcgtcgaggccggcgaggcgaacggcgtccggctggac
ctcgccgcggccggtgcggaacgcttcgcccgggccgccgcccagggacacggcgacgag
gacatggcggcggcctacttcgccagtttcgaggagaaggcgagcgactga

DBGET integrated database retrieval system