KEGG   Streptomyces coelicolor: SCO0923Help
Entry
SCO0923           CDS       T00085                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO0923 (sdhA)
   00650 Butanoate metabolism
    SCO0923 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO0923 (sdhA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCO0923 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SCO0923 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(968638..970587)
Genome map
AA seq 649 aa AA seqDB search
MTTYADYTTGEPVADTKAPAGPVNERWDTRRFEAKLVNPANRRGKTVIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIHRLFYDTVKGGDFRSR
ESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALSRQIAAGTIEMHARTEMLDLIVVDGRARGIVARDLVTGKIDTYYADAVVLASGGY
GNVFYLSTNAMNSNATAVWRAHRRGAYFANPCFTQIHPTCIPRTGDHQSKLTLMSESLRN
DGRIWVPKAKGDDRPANKIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIKRMGRKAVEAKYGNLFDMYQRITDEDPYRVPMRIYPAVHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPATINDYLARNPLGDDV
DDDHPVVQEVLAETEDRLNLLLSVDGDRTPDSFHRELGELMWEFCGMARTDSGLRKALER
IPQIREEFWRRIKVPGTGEEFNQSLEKANRIVDYLELAELMCLDALHRAESCGGHFREES
QTPDGEAARRDEEFGYAAAWEFTGTGDAPTLHKEDLVFEYVHPTQRSYA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctacgccgactacacgaccggggagccggtcgccgacaccaaggcccccgcc
ggacccgtcaacgagcgctgggacacgcgccgtttcgaggcgaagctggtcaaccccgcc
aaccggcgcggcaagaccgtcatcgtcgtcggcaccggcctcgcgggcggctccgcgggc
gcgaccctggccgaacagggctaccacgtcgtccagttctgctatcaggactccccgcgc
cgggcccactccatcgccgcgcagggcggcatcaacgccgcgaagaactaccgcaacgac
ggcgactcgatccaccgcctgttctacgacaccgtcaagggcggcgacttccgctcccgc
gagtccaacgtccaccggctggcgcagatctcggtcgagatcatcgaccagtgcgtggcg
cagggcgtgccgttcgcccgtgagtacggcggtctgctcgacacccgctccttcggcggc
gtgcaggtctcccgcaccttctacgcccgcggccagacagggcagcagctgctgctcggc
gcctaccaggcgctcagccggcagatcgcggccggcaccatcgagatgcacgcccgcacc
gagatgctcgacctgatcgtcgtcgacggccgggcccgcggcatcgtcgcccgggacctg
gtcaccgggaagatcgacacctactacgcggacgccgtcgtcctggccagcggcggctac
ggcaacgtcttctacctctccaccaacgccatgaactccaacgcgaccgccgtctggcgg
gcgcaccggcgcggtgcctacttcgccaacccctgcttcacgcagatccacccgacctgc
attccgcgcaccggcgaccaccagtccaagctgacgctgatgagcgagtcgctgcgcaac
gacggccggatctgggtgcccaaggccaagggcgacgaccggcccgcgaacaagatcccc
gaggacgagcgcgactactacctggagcgcatctacccgtccttcggcaacctggtcccg
cgcgacatcgcctcccgcgccgcgaagaacgtctgcgacgagggcaggggagtgggtccc
ggcggccagggcgtgtacctggacttcgccgacgcgatcaagcgcatgggccgcaaggcg
gtcgaggccaagtacggcaacctcttcgacatgtaccagcggatcaccgacgaggacccg
taccgggtgcccatgcggatctacccggcggtgcactacacgatgggcggactgtgggtc
gactacgacctccagaccaccgtccccggcctgttcgcgatcggcgaggccaacttctcc
gaccacggcgccaaccggctcggcgcctccgcgctgatgcagggcctggccgacggctac
ttcgtactgccggccaccatcaacgactacctcgcccgcaacccgctgggggacgacgtc
gacgacgaccacccggtggtccaggaggtgctggccgagaccgaggaccggctgaacctg
ctgctgtccgtggacggcgaccgcaccccggactccttccaccgggaactgggcgagctg
atgtgggagttctgcggcatggcccgcaccgactccggcctgcgcaaggccctggagcgc
atcccgcagatccgcgaggagttctggcggcgcatcaaggtccccggcaccggcgaggag
ttcaaccagtcgctggagaaggccaaccgcatcgtcgactacctggaactcgccgagctg
atgtgcctcgacgcgctgcaccgcgccgagtcctgcggcggccacttccgcgaggagtcc
cagaccccggacggcgaggcggcccgcagggacgaggagttcggctacgccgcggcctgg
gagttcaccggcaccggtgacgcccccaccctgcacaaggaagacctggtcttcgagtac
gtccaccccacccagcggagctacgcatga

DBGET integrated database retrieval system