KEGG   Streptomyces coelicolor: SCO0978Help
Entry
SCO0978           CDS       T00085                                 

Gene name
panD, SCBAC19F3.05c
Definition
(RefSeq) aspartate alpha-decarboxylase
  KO
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO0978 (panD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO0978 (panD)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     SCO0978 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1030387..1030806)
Genome map
AA seq 139 aa AA seqDB search
MLRTLIKSKIHRATVTQADLHYVGSVTIDADLLDAADLLPGELVHIVDVTNGARLETYVI
EGERGSGVIGINGAAAHLVHPGDLVILISYAQVTDAEARSLRPRVVHVDGDNRIVGLGAD
ASEPVPGSDQERSPQAVSA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgaactttgatcaagtccaagatccaccgcgccaccgtcacccaggccgacctg
cactacgtcggctcggtgaccatcgacgccgatctcctggacgctgccgatctgctgccc
ggtgagctcgtgcacatcgtggacgtcaccaacggggcccggctggagacgtacgtcatc
gagggggagcgcgggtccggggtgatcgggatcaacggggccgcggcccacctcgtgcac
cccggtgacctggtgatcctcatcagctacgcccaggtcaccgacgccgaggcgcggtcg
ctgcggccccgggtcgtgcacgtggacggggacaaccgtatcgtcggcctcggcgccgac
gcgtcggagccggtaccgggctcggaccaggagcgcagccctcaggccgtgtcggcctga

DBGET integrated database retrieval system