KEGG   Streptomyces coelicolor: SCO1018Help
Entry
SCO1018           CDS       T00085                                 

Gene name
2SCG2.32c
Definition
(RefSeq) glutamate racemase
  KO
K01776  
glutamate racemase [EC:5.1.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCO1018 (2SCG2.32c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SCO1018 (2SCG2.32c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1073299..1074141)
Genome map
AA seq 280 aa AA seqDB search
MRSLPHGTGRWRRIVYGGRVKIALMDSGIGLLAATAAVRRLRPDADLILSLDPDGMPWGP
RTPKDLTGRALGVAEAAAAHRPDALIVGCNTATVHALPALRARLEPDVPVIGTVPAIKPA
AAGGGPVAIWATPATTGSPYQRGLIEDFAGDTEVTEVPCPGLADAVEHADETAITEAVAA
AAALTPDDVTTVVLGCTHYELVAERIRAAVQRPGAPRLVLHGSAGAVAAQALRRIGARPD
PGAPATGTLTVLLSGREGTLPAPALAYDEGRLLRAVTPAG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagtctgccgcacggcacgggccggtggcggcgcatcgtctatggtggccgggtg
aagatcgcgctcatggactccggaatcggtctgctggcggccaccgccgcggtacggcgg
ctgcgaccggacgccgatctcatcctctccctggaccccgacgggatgccctggggcccg
cggaccccgaaggacctgaccgggcgtgccctcggcgtggccgaggccgccgcggcgcac
cgcccggacgccctgatcgtcggctgcaacaccgccacggtgcacgcgctgcccgcgctg
cgcgcccggctcgagcccgacgtacccgtcatcggcaccgtgccggcgatcaagcccgcc
gcggccggtggcggcccggtggcgatctgggcgacgccggccaccacgggaagcccctac
cagcggggcctgatcgaggacttcgcgggggacacggaggtcaccgaggtgccgtgcccg
ggcctcgccgacgccgtcgagcacgcggacgagaccgcgatcaccgaggccgtcgccgcc
gcggccgccctcacacccgacgacgtgacgacggtcgtcctgggctgcacccactacgaa
ctggtcgccgaacgcatccgcgccgccgtgcagcgccccggtgccccgcggctcgtcctg
cacggctccgccggagccgtggccgcccaggcgctgcgccggatcggcgcccgccccgac
ccgggcgccccggcgacgggcaccctgaccgtgctgctgagcggacgcgagggcactctg
cccgcgcccgcgctggcctacgacgagggtcggctgctgcgcgcggtcacgccggccggc
tga

DBGET integrated database retrieval system