KEGG   Streptomyces coelicolor: SCO1077Help
Entry
SCO1077           CDS       T00085                                 

Gene name
SCG22.23c
Definition
(RefSeq) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00052  Galactose metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco00521  Streptomycin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1077 (SCG22.23c)
   00052 Galactose metabolism
    SCO1077 (SCG22.23c)
   00500 Starch and sucrose metabolism
    SCO1077 (SCG22.23c)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO1077 (SCG22.23c)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO1077 (SCG22.23c)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCO1077 (SCG22.23c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCO1077 (SCG22.23c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-GeneID: 1096500
NCBI-ProteinID: NP_625371
Kitasato: SCO1077
UniProt: Q9K422
Position
complement(1137148..1138101)
Genome map
AA seq 317 aa AA seqDB search
MHTDLVAALDIGGTKIAGALVDGHGRIQARAQRATPAREDGDTVMRAVEDVLAELTVSPL
WGRASAVGIGSAGPVDASAGTVSPVNVPGWRDYPLVRRVQAAAGGLPVELIGDGVAITAA
EHWQGAARGHDNALCMVVSTGVGGGLVLGGRLHPGPTGNAGHIGHISVDLDGDPCPCGAR
GCVERIASGPNIARRALEAGWLPGPDGDTSAAAVAASARLGDPVAVASFERAAQALAAGI
AATATLVEIDIAVVGGGVGKAGDVLFAPLRKALTDYATLSFVQRLAVVPAQMGTDAGLVG
AAAAALTRTADVTAAHV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgacctcgtggcagcgctggacatcggcggcaccaagatcgccggcgcgctg
gtggacggccacggccgcatccaggcgcgcgcacagcgtgcgacacccgcccgggaggac
ggtgacaccgtgatgcgggccgtcgaggacgtgctcgccgaactgaccgtgtcgcccctg
tgggggcgggcctcggcggtcggcatcggcagcgccggtccggtggacgcctcggccggc
acggtcagcccggtgaacgtgcccggctggcgcgactacccgctggtccgacgggtccag
gccgccgccggcggccttccggtggagctgatcggcgacggggtggccatcacggcggcc
gaacactggcagggcgccgcccgcgggcacgacaacgcgctgtgcatggtggtctcgacc
ggcgtcggcggcggactggtgctgggcggccggctgcaccccggaccgaccggcaacgcc
ggccacatcggccacatcagcgtcgacctggacggcgacccctgcccctgcggtgcgcgc
ggctgcgtggagcgcatagcgagcggccccaacatcgcccgccgcgcgctggaggccggc
tggctgcccggaccggacggcgacacctccgccgccgcggtcgccgcctcggcgcgcctc
ggcgaccccgtggccgtcgcctccttcgaacgggccgcgcaggcactggccgccggtatc
gccgccacggcgaccctcgtcgagatcgacatcgccgtggtgggcgggggagtgggcaag
gcgggggacgtcctcttcgccccgctgcgcaaggccctcaccgactacgcgacgctgtcc
ttcgtccagcgcctcgcggtcgtccccgcccagatgggcacggacgccggactggtcggc
gcggccgccgcggctctgacgaggacggcggacgtgaccgccgcccacgtctga

DBGET integrated database retrieval system