KEGG   Streptomyces coelicolor: SCO1083Help
Entry
SCO1083           CDS       T00085                                 

Gene name
SCG22.29c
Definition
(RefSeq) flavin-dependent reductase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1143786..1144295)
Genome map
AA seq 169 aa AA seqDB search
MTVTPDLAAPRPATDDLLRSVFRRHAAGVAVITARGPGGPAGFTATSLTSVSARPPLLSF
GIGAGSSSWPAVSEAEHVGVHVLGEHQEELAATFARSGADRFAAPTVWREGPEGVPVLEG
VLAWLVCRVVGRVPAGDHRIVLAEVLLGDPAGAGEPLLYHQGRYRGLRG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcacacccgacctggccgcaccccggcccgccaccgacgacctgctgcggtcc
gtcttccggcggcacgccgcgggtgtcgccgtgatcaccgcgcggggccccggcggcccg
gccggtttcacggccacgtccctcacctccgtctccgcccgcccgccgctgctctccttc
ggcatcggcgccggctcgtcgagctggcccgcggtgtccgaggcggagcacgtcggcgtc
cacgtgctcggcgagcaccaggaggagctggcggccaccttcgcccgcagcggcgccgac
cgtttcgccgcacccaccgtctggcgggaggggcccgagggggtgcccgtgctggagggc
gtgctcgcctggctcgtgtgccgggtggtcggccgggtgcccgcgggggaccatcggatc
gtgctggccgaagtcctcctcggcgaccccgccggagccggcgagccgctgctgtaccac
caggggcgttaccggggtctgcgcggctga

DBGET integrated database retrieval system