KEGG   Streptomyces coelicolor: SCO1087Help
Entry
SCO1087           CDS       T00085                                 

Gene name
2SCG4.03c
Definition
(RefSeq) aldolase
  KO
K01620  
threonine aldolase [EC:4.1.2.48]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1087 (2SCG4.03c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO1087 (2SCG4.03c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SCO1087 (2SCG4.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1146486..1147556)
Genome map
AA seq 356 aa AA seqDB search
MNPPKTDARRHHDPEVRGFASDNYAGAHPEVLAALALANGGHQVAYGEDDYTENLQRVIR
SHFGSGAEAFPVFNGTGANVVALQAVTDRWGAVICAESAHINVDEGGAPERMGGLKLLTV
PTPDGKLTPELIDRQAYGWDDEHRAMPQVVSITQSTELGTLYTPDEIRAVCEHAHAHGMK
VHLDGSRIANAAASLDVPMRTFTNAVGVDLLSLGGTKNGALFGEAVVVLNQDAVRHMKHL
RKLSMQLASKMRFVSVQLEALLAKDLWLRNARHSNEMAQRLAEGVRAVHGVEILYPVQAN
AVFARLPHEVSERLQKRFRFYFWDEAAGDVRWMCAFDTTENDVDAFVSALKEEMAR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaccgaagaccgacgcgcgtcgccatcacgaccccgaggtccgcggtttcgcc
agtgacaactacgccggggctcacccggaagtactcgccgcgctggcgctggccaacggc
gggcaccaggtcgcgtacggcgaggacgactacaccgagaacctccagcgcgtgatccgc
agccacttcggctccggcgccgaggcgttcccggtcttcaacggcaccggcgccaacgtc
gtcgcgctccaggcggtcaccgaccgctggggcgcggtgatctgcgccgagagcgcgcac
atcaacgtcgacgagggcggcgcccccgagcgcatgggcggcctcaagctgctcaccgtc
cccacccccgacggcaagctcacgcccgagctgatcgaccgccaggcctacggctgggac
gacgagcaccgggcgatgccgcaggtcgtctcgatcacccagagcaccgagctgggcacc
ctctacacgcccgacgagatccgcgccgtctgcgagcacgcccacgcgcacggcatgaag
gtgcacctggacggctcccggatagccaacgccgccgcctcgctggacgtgcccatgcgc
acgttcaccaacgcggtcggcgtcgacctcctctccctcggcggcaccaagaacggcgcg
ctgttcggcgaggcggtcgtcgtcctgaaccaggacgccgtgcgccacatgaagcacctg
cgcaagctgtccatgcagctggcctccaagatgcgcttcgtgtccgtgcagctggaggcg
ctgctggccaaggacctgtggctgcgcaacgcccggcactccaacgagatggcccagcgc
ctggccgagggcgtgcgcgccgtgcacggcgtggagatcctctacccggtgcaggccaac
gcggtcttcgcccggctgccgcacgaggtgagcgagcgcctgcagaagcggttccgcttc
tacttctgggacgaggccgccggcgacgtgcgctggatgtgcgccttcgacaccaccgag
aacgacgtcgacgctttcgtgtccgccctcaaggaagagatggcgcgctga

DBGET integrated database retrieval system