KEGG   Streptomyces coelicolor: SCO1170Help
Entry
SCO1170           CDS       T00085                                 

Gene name
2SCG11.04, SCG11A.01, xylB
Definition
(RefSeq) xylulose kinase
  KO
K00854  
xylulokinase [EC:2.7.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO1170 (2SCG11.04)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     SCO1170 (2SCG11.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1231648..1233093
Genome map
AA seq 481 aa AA seqDB search
MSAAEGPLVVGVDTSTQSTKALVVDAATGRVVASGQAPHTVSSGTGRESDPRQWWDALGE
ALSQCGEAAREAAAVSVGGQQHGLVTLDARGEPVRPALLWNDVRSAPQARRLIDELGGAK
AWAERTGSVPSASFTVTKWAWLTEHEPEAARAVKAVRLPHDYLTERLTGEGTTDRGDVSG
TGWWASGTEAYDEEILARVALDPALLPRVVRPGEVAGTVRDGHGLPFSKGTLVAAGTGDN
AAAALGLGLRPGVPVMSLGTSGTAYAVSQRRPADPTGTVAGFADARGDWLPLACTLNCTL
AVDRVASLLGLDREAVEPGTDVTLLPFLDGERTPNLPHSSGLLHGLRHDTTAGQLLQAAY
DGAVHSLLGALDLVLDADADPSAPLLLIGGGARGTAWQQTVRRLSGRPVQIPEARELVAL
GAAAQAAGLLTGEDAAAVARRWNTAAGPVLDAVERDEATLNRITGVLSDAAPLLERDAAS
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagccgagggtccgctcgtcgtcggcgtggacacgtccacccagtccaccaag
gcgctggtcgtcgacgcggccaccggccgggtcgtcgcgagcggccaggcgccccacacc
gtgtcctccgggaccggccgcgagagcgatccccgccagtggtgggacgcgctgggcgag
gccctgagccagtgcggcgaggccgcccgcgaggccgccgcggtgtccgtcggcgggcag
cagcacggtctggtcacgctggacgcccggggcgagccggtgcgccccgccctgctctgg
aacgacgtgcgctcagctccgcaggcccgccggctgatcgacgagctgggcggggccaag
gcctgggcggagcgcacggggagcgtgcccagcgcctccttcacggtcaccaagtgggcc
tggctgaccgagcacgagccggaggcggcccgcgcggtgaaggccgttcggctcccccac
gactacctcaccgagcgcctcaccggcgaggggaccaccgaccgcggggacgtgtccggc
accggctggtgggcgtcgggcacggaggcctacgacgaggagatcctcgcgcgcgtggcg
ctcgatccggccttgctgccccgggtggtccggcccggtgaggtggccggcaccgtacgc
gacggccacggcctgccgttctccaagggcactctggtcgccgccggcaccggcgacaac
gcggccgccgcgctgggtctcggactgcgccccggcgtcccggtcatgagtctcggcact
tcgggcacggcctacgccgtgtcgcagcgtcggcccgccgacccgacgggcaccgtggcg
ggcttcgccgacgcgcgcggcgactggctgccgctggcctgcaccctcaactgcacgctc
gccgtggaccgcgtcgcgtccctgctgggcctggaccgggaagccgtcgagccgggcacc
gacgtcaccctgctgcccttcctcgacggcgagcgcacaccgaacctcccgcactcctcc
ggcctcctgcacgggctgcgccacgacacgaccgccggacagctgctccaggccgcgtac
gacggcgccgtccactcgctgctcggcgcgctcgacctcgtcctcgacgccgacgcggac
ccgtccgcgcccctgctgctgatcggcggcggtgcccgggggacggcctggcagcagacg
gtacggcggctgtccgggcgcccggtccagatcccggaggccagggagctggtcgcgctc
ggtgccgcggcgcaggcggccggtctgctgaccggcgaggacgcggcagcggtcgcccga
cgctggaacacggccgccgggccggtactcgacgccgtggaacgggacgaggcgacgctg
aaccggatcaccggggtactctccgacgcggcaccgctgctggaacgggacgcggcctcc
cgctga

DBGET integrated database retrieval system