KEGG   Streptomyces coelicolor: SCO1174Help
Entry
SCO1174           CDS       T00085                                 

Gene name
SCG11A.05, thcA
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1174 (SCG11A.05)
   00620 Pyruvate metabolism
    SCO1174 (SCG11A.05)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SCO1174 (SCG11A.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
1237012..1238535
Genome map
AA seq 507 aa AA seqDB search
MTRYAAPGTEGAIVSYQSRYDHFIGGEYVPPARGQYFENPSPVNGLPFTEIARGTADDVE
RALDAAHEAAPGWGRTSVTERSDILLKIADRMEANLERLAVAESWENGKPVRETLAADIP
LAIDHFRYFAGAVRAQEGSLGEIDDDTVAYHFHEPLGVVAQIIPWNFPILMATWKLAPAL
AAGNAVVLKPAEQTPASIHYWLSLVADLLPPGVLNVVNGFGVEAGKPLASSPRVAKVAFT
GETTTGRLIMQYASENIKPVTLELGGKSPNIFFEDVWARDDDFRDKALEGFTMFALNQGE
VCTCPSRALVQRGVYAEFMEAAVARTELIKPGHPLDTDTMIGAQASNDQLEKILSYLDIG
RQEGAKVLTGGERIEHDGELKGGYYVQPTIFEGHNRMRIFQEEIFGPVVSVTSFDDFDDA
VKTANDTLYGLGAGVWTRDMNTAYRAGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
NHKMMLEHYQQTKNILCSYSPKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttacgcggcgcccggcaccgagggcgcgatcgtctcctatcagtcgcgctac
gaccacttcatcggcggcgagtacgtgccaccggcgcgcgggcagtacttcgagaacccg
tccccggtgaacggcctgccgttcaccgagatcgcgcgcggcacggccgacgacgtggaa
cgggcgctcgacgccgcgcacgaggccgctccgggctggggccgtacctcggtgaccgag
cgttccgacatcctcctgaagatcgccgaccgcatggaggcgaacctggagcgcctggcg
gtcgcggagagctgggagaacggcaagccggtgcgcgagactctggcggccgacatcccc
ctcgccatcgaccacttccgctacttcgcgggcgcggtgcgcgcccaggagggctcactc
ggcgagatcgacgacgacaccgtggcgtaccacttccacgaaccgctgggggtcgtcgcc
cagatcatcccgtggaacttcccgatcctgatggccacctggaagctcgcgcccgccctc
gccgccggcaacgccgtggtcctgaagcccgcggagcagaccccggcctcgatccactac
tggctgagcctggtggcggacctgctgccgcccggggtcctgaacgtcgtcaacggcttc
ggggtggaggcgggcaaaccgctcgcgtcgagcccccgggtggcgaaggtggcgttcacc
ggcgagaccaccaccgggcggctgatcatgcagtacgcctcggagaacatcaaaccggtc
acgctggagctgggcggcaagtcgccgaacatcttcttcgaggacgtctgggcgcgggac
gacgacttccgcgacaaggcgctcgagggcttcaccatgttcgcgctcaaccagggggag
gtctgcacctgtccgtcccgcgcgctcgtccagcggggcgtctacgccgagttcatggag
gcagccgtcgcgcgcaccgagttgatcaagcccggtcaccccctggacaccgacacgatg
atcggcgcccaggcctccaacgaccagttggagaagatcctctcctacctggacatcggc
cgccaggagggcgcgaaggtactcaccggtggtgagcggatcgagcacgacggcgagttg
aagggcggctactacgtccagccgacgatcttcgagggccacaaccgcatgcggatcttc
caggaggagatcttcggcccggtggtgtcggtgacgtccttcgacgacttcgacgacgcc
gtcaagaccgccaacgacaccctgtacggcctcggcgccggggtgtggacccgcgacatg
aacaccgcgtaccgcgcgggccgcgcgatccaggcgggacgcgtgtggacgaactgctac
cacgcatacccggcgcacgccgccttcggcggctacaagcagtcgggcatcggccgggag
aaccacaagatgatgctggagcactaccagcagacgaagaacattctttgttcctacagc
cccaagaaactcgggttcttctag

DBGET integrated database retrieval system