KEGG   Streptomyces coelicolor: SCO1176Help
Entry
SCO1176           CDS       T00085                                 

Gene name
SCG11A.07c
Definition
(RefSeq) dihydroxy-acid dehydratase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1239663..1241453)
Genome map
AA seq 596 aa AA seqDB search
MTDEPRTSRRSQAWFGAQGRSGMVYRSWMRSQGFGHEVFDGRPVIGIATSASELAPCNAH
LTRVAEAVKRGVWQAGGFPLQFPTMATGETLMRPTAMLYRNLMAMEVEELIRANPLDGVV
LLSGCDKTTPAMLMGAASVDLPAVMVTGGPMLNGKYRGQDVGSGTHVWKFEEDLKTGRMT
EEECFFAEGCMARSNGHCMTMGTASTMACLAEALGMQLPGSAAWPAVDSRRMETAQAAGQ
RIVGMVEEELRPSRILTREAFENAVRVNAAIGGSTNAVIHLLAIAGRVGVDLSLRDFDEL
ARAVPTLVNLMPSGKYLMEDFCYAGGLPAVLAELLGGGLLHGSQITVTGRTIAENNTGST
DNTGNTGNTERVGSDPDPDPDFDVITRLDAPFQPAGTGIAVLRGNLCPDGAVIKQSAASP
HLLTHRGPARVFDSPEAYHEVADDPDLDIDENTVIVIRNAGPKGYPGMPEVANVPLPAKL
LKAGVKDMVRVCDGRMSGTGYGTVVLHVAPEAAVGGPLALVHDGDPVVLDVPHRTLRLDV
DDAELTRRRRAWRAPAERHAGGYAWLYTQNVEQADRGADFGFLRGNRGHEVPRDSH
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaaccgaggacgagtcgccgcagccaggcgtggttcggcgcacagggccgc
agcggcatggtgtaccgctcctggatgcgcagccagggcttcggccacgaggtgttcgac
ggacgccccgtcatcggcatcgcgaccagtgcctccgaactcgccccgtgcaacgcccac
ctcacccgcgtcgccgaggccgtcaagcgcggggtgtggcaggccggcggcttcccgctg
cagttccccaccatggccaccggcgagacgctgatgcgccccaccgccatgctgtaccgc
aacctcatggccatggaggtcgaggagctgatccgggccaatccgctcgacggtgtggtg
ttgctgtcgggctgcgacaagacgacccccgccatgctcatgggcgccgccagcgtcgac
ctgcccgccgtcatggtcaccggcgggccgatgctcaacggcaagtaccgggggcaggac
gtgggatccggcacccatgtgtggaagttcgaggaggacctgaagaccggccggatgacc
gaggaggagtgcttcttcgcggaaggctgcatggcccgctccaacgggcactgcatgacg
atggggaccgcctcgacgatggcctgcctggccgaggcgctcggcatgcagctgccgggc
tcggcggcctggcccgcggtcgactcccggcggatggagaccgcgcaggccgcggggcag
cgcatcgtggggatggtggaggaggagctgcgcccctctcggatcctgacccgtgaggcg
ttcgagaacgccgtccgggtcaacgcggccatcggcggctccacgaacgccgtcatccat
ctcctggccatcgccgggcgcgtcggcgtcgacttgagcctgcgggacttcgacgaactg
gcccgtgcggtgccgaccctggtcaacctgatgcccagcggcaagtacctcatggaggac
ttctgctacgcgggcggcctgcccgcggtactggccgaactgctcggcggcgggctgctg
cacggcagccagatcacggtcaccggacgcaccatcgccgagaacaacacggggagcacc
gacaacaccgggaacaccgggaacaccgaacgggtcggctccgaccccgaccccgacccc
gacttcgacgtcatcacccgcctcgacgcccccttccagccggccggcaccgggatcgcc
gtcctccgcggcaacctgtgccccgacggcgccgtgatcaagcagtccgccgcgtcaccg
cacctgctcacccaccgcggccccgcacgcgtcttcgactctcccgaggcgtatcacgag
gtggccgacgacccggatctcgacatcgacgagaacaccgtcatcgtcatccgcaacgcc
ggccccaagggctaccccggcatgcccgaggtcgccaacgtccccctgcccgccaagctg
ctgaaggccggcgtcaaggacatggtgcgcgtctgcgacgggcggatgagcggcaccggc
tacgggacggtggtcctgcacgtggcacccgaggccgccgtcggcggacccctcgccctg
gtccacgacggggacccggtcgtcctcgacgtcccccaccgcaccctgcgcctggacgtc
gacgacgccgagctcacgcgacgcaggcgggcgtggcgggcacccgccgaacggcacgcc
ggcggttacgcctggctctacacccagaacgtcgaacaggccgaccggggcgccgacttc
ggattcctgcggggaaaccgcggacacgaggttccccgagactcccactga

DBGET integrated database retrieval system