KEGG   Streptomyces coelicolor: SCO1204Help
Entry
SCO1204           CDS       T00085                                 

Gene name
gabD1
Definition
(RefSeq) succinic semialdehyde dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO1204 (gabD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1204 (gabD1)
   00310 Lysine degradation
    SCO1204 (gabD1)
   00350 Tyrosine metabolism
    SCO1204 (gabD1)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO1204 (gabD1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SCO1204 (gabD1)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SCO1204 (gabD1)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SCO1204 (gabD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1275830..1277215
Genome map
AA seq 461 aa AA seqDB search
MPIATVNPANGETLRTYEAMGEEEIERRIELAEATFRTYRTTGFYERAGLMRRAADLLEA
DQKEIGKVITTEMGKPVKQARAEAAKCAKAMRWYADHAAELLADEEPAEADVKDSGASRA
LVRYRPLGPVLAVMPWNFPLWQVIRFAAPALMAGNVGLLKHASNVPQTALYLEDLFHRAG
FPEGCFQTLLIGSAQVDDVLRDERVRAATLTGSEPAGRAVAATAGEMIKKTVLELGGSDP
FVVMPSADVERAAEVAVTARTQNAGQSCIAAKRFIVHTDVYDAFAQRFTEGMRALKVGDP
MDEETEVGPLSSEQGLNDLVELVDDAVRGGASVLCGGERPDGPGWYYPPTVLAGVTRELR
IHREEAFGPVATLYRAADLDEAVLIANDTDFGLSSNVWTRDDADVDRFVRDLEAGGVYVN
GMTASHPAFPFGGVKRSGYGRELSGHGIREFCNITTVWHGA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgcgacggtgaacccggcgaacggcgagacgctcaggacgtacgaggccatg
ggcgaggaggagatcgagcgccggatcgagctcgcggaggccaccttccgcacctaccgg
accacggggttctacgagcgggccgggctgatgcgccgcgccgccgaccttctcgaggcc
gatcagaaggagatcgggaaggtcatcaccacggagatgggcaagccggtgaagcaggcc
cgcgcggaggcggccaagtgcgccaaggcgatgcgctggtacgccgaccacgcggcggag
ctgctggccgacgaggagcccgccgaggccgacgtgaaggactccggcgcctcccgggcc
ctggtccgctaccggccgctcggcccggtgctcgcggtgatgccgtggaacttcccgctc
tggcaggtgatcaggttcgcggcgcccgcgctgatggcgggcaacgtcgggctgctcaag
cacgcctcgaacgtgccgcagaccgccctctacctggaggacctgttccaccgggcgggc
ttccccgagggctgcttccagacgctcctcatcggttccgcccaggtcgacgacgtcctg
cgcgacgaacgggtacgggccgccaccctcaccggcagcgagcccgcgggccgcgcggtg
gccgccacggccggggagatgatcaagaagacggtgctcgagctgggcggcagcgacccg
ttcgtcgtcatgccgtccgccgacgtcgaacgggccgcggaggtggcggtgaccgcgcgc
acccagaacgccggtcagtcgtgcatcgccgccaagcggttcatcgtgcacacggacgtc
tacgacgccttcgcccagcgcttcaccgagggcatgcgggcgctgaaggtcggcgacccg
atggacgaggagaccgaggtcggcccgctctccagcgagcagggcctgaacgacctggtg
gagctggtcgacgacgcggtgcgcggcggcgcgagcgtgctgtgcggcggcgaacgtccg
gacgggcccggctggtactacccgccgaccgtcctggcgggcgtcacccgcgagctgcgc
atccaccgcgaggaggccttcggaccggtcgccacgctctaccgggcggccgacctggac
gaggcggtcctgatcgccaacgacacggacttcgggctcagttcgaacgtgtggacgcgc
gacgacgcggacgtggaccgtttcgtccgggacctggaggcgggcggcgtgtacgtgaac
gggatgacggcgtcccacccggcgttcccgttcggcggggtcaagcggtcgggctacggg
cgtgagctgtccgggcacggaatccgcgagttctgcaacatcaccaccgtatggcacgga
gcgtga

DBGET integrated database retrieval system