KEGG   Streptomyces coelicolor: SCO1223Help
Entry
SCO1223           CDS       T00085                                 

Gene name
2SCG58.23, rocD
Definition
(RefSeq) ornithine aminotransferase
  KO
K00819  
ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO1223 (2SCG58.23)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SCO1223 (2SCG58.23)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO1223 (2SCG58.23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1293687..1294910
Genome map
AA seq 407 aa AA seqDB search
MTAPVRTARGSEELIRAEEPVLAHNYHPLPVVVARAEGAWVEDVEGRRYLDMLAGYSALN
FGHRHPALVEAAHRQLDRLTLTSRAFHNDRLAGFAERLAALTGTDMVLPMNTGAEAVESG
IKVARKWAYDVKGVPADRATIVVAADNFHGRTTTIVSFSTDETARSGFGPFTPGFRIVPY
NDLAALEAAVDETTAAVLIEPIQGEAGVLIPDDGYLAGVRELTRRKGCLFVADEIQSGLG
RTGHTLAVEHESVVPDVVLLGKALGGGIVPVSAVVGRRDVLGVLHPGEHGSTFGGNPLAA
AVGTAVVELLETGAFQRRAAELGAVLREGLAALVGRGVVGFRARGLWAGVDVDPALGSGR
EISERLMREGILVKDTHGSTIRLAPPLTVTAEELTGALGTLEKVLTS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgtccgcaccgcccgcggctccgaggaactgatccgcgcggaggagccc
gtcctcgcgcacaactaccacccgctgcccgtcgtcgtggcccgcgccgagggcgcctgg
gtcgaggacgtcgagggccgccgctacctggacatgctggccggctactcggcgctcaac
ttcggccatcgccacccggcactggtcgaggccgcccaccggcagctggaccggctcacg
ctcacctcgcgggccttccacaacgaccggctcgcgggcttcgccgagcggctggccgca
ctgaccggcacggacatggtgctgcccatgaacaccggcgcggaggcggtggagagcggc
atcaaggtggcccgcaagtgggcctacgacgtcaagggcgtcccggccgaccgggcgacg
atcgtggtcgcggcggacaacttccacggccgtacgacgacgatcgtgagcttctccacc
gacgagaccgcccgctccggcttcggccccttcaccccgggcttccggatcgtgccgtac
aacgacctcgcggcgctggaggcggcggtcgacgagacgacggcggccgtgctgatcgag
ccgatccagggcgaggcgggcgtgctgatccccgacgacggctatctggccggggtgcgg
gagctgacccgccgcaagggctgcctgttcgtcgcggacgagatccagtccggtctgggc
cgcacggggcacaccctggccgtcgagcacgagtcggtcgtgccggacgtggtgctgctc
ggcaaggcgctgggcggcggcatcgtcccggtgtcggcggtggtcggccggcgtgacgtg
ctgggtgtgctgcacccgggcgagcacggttcgacgttcggcggcaatccgctggccgcc
gcggtgggcacggcggtggtggaactgctggagaccggcgcgttccagcgccgggcggcc
gagctgggcgcggtgctgcgcgaggggctggccgccctggtcggcaggggtgtcgtcggc
ttccgggcgcgggggctgtgggcgggcgtggacgtggacccggcgctgggcagcggacgc
gagatcagtgagcggctgatgcgcgagggcatcctggtcaaggacacccacggctccacg
atccgcctggccccaccgctgaccgtcacggccgaggagctgacgggcgccctggggacg
ctggagaaggtcctcacctcctga

DBGET integrated database retrieval system